Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
NAGS antibody
NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
MURF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes.
Dhh antibody
Dhh antibody is a monoclonal antibody that specifically targets the Dhh protein, which is a growth factor involved in the development and maintenance of pluripotent stem cells. This antibody has been extensively studied and shown to have high specificity and affinity for Dhh, making it an ideal tool for research purposes. It can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry. The Dhh antibody has been validated using primary cells and has shown excellent performance in detecting Dhh expression in various tissues. Its unique amino-acid sequences allow it to recognize specific epitopes on the Dhh protein, ensuring accurate and reliable results. Furthermore, this antibody has potential as a biomarker for certain diseases or conditions related to Dhh signaling pathway dysregulation. Its use can provide valuable insights into the biological effects of Dhh and its role in cellular processes such as syncytia formation.
TGF alpha antibody
The TGF alpha antibody is a monoclonal antibody that specifically targets the growth factor known as transforming growth factor alpha (TGF alpha). TGF alpha is a glycoprotein that plays a crucial role in cell proliferation and differentiation. By binding to TGF alpha, this antibody inhibits its activity and prevents it from interacting with its receptor on the cell surface.
PUF60 antibody
The PUF60 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the PUF60 protein, which is involved in various cellular processes. This antibody can be used to study the role of PUF60 in different biological pathways, such as RNA processing, DNA repair, and gene expression regulation. The PUF60 antibody has been widely used as a tool for investigating the function and localization of PUF60 within cells. It can be utilized in techniques like immunofluorescence and immunohistochemistry to visualize the distribution of PUF60 in various tissues and cell types. Additionally, this antibody can also be used for protein-protein interaction studies or as an inhibitor by blocking the activity of PUF60. Overall, the PUF60 antibody is a valuable tool for researchers studying the functions and mechanisms of the PUF60 protein in cellular processes.
Desmoglein 3 antibody
Desmoglein 3 antibody was raised in mouse using recombinant human polypeptide Desmoglein 3 as the immunogen.
