Anticorps primaires

Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.

CD70 antibody was raised in rabbit using the N terminal of CD70 as the immunogen

Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV

The Phospholamban antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize phospholamban, an inhibitory factor involved in the regulation of calcium uptake and release in cardiac muscle cells. This antibody has been extensively tested and shown to effectively lyse phospholamban-expressing cells, making it a valuable tool for researchers studying the role of phospholamban in various physiological processes. Additionally, this antibody has also been found to have neutralizing effects on certain autoantibodies, such as antiphospholipid antibodies, and can modulate the activity of colony-stimulating factors like GM-CSF. With its high specificity and potency, the Phospholamban antibody is an essential component for any research project involving phospholamban or related proteins.

The TFE3 antibody is a polyclonal antibody that specifically targets the beta-hairpin region of the TFE3 protein. This antibody is widely used in life sciences research, particularly in assays related to growth factors, insulin, and inhibitors. The TFE3 antibody has been shown to effectively detect and neutralize superoxide, making it a valuable tool for studying oxidative stress-related processes. Additionally, this antibody has demonstrated cytotoxic effects against cancer cells expressing high levels of c-myc and endothelial growth factors. Researchers also utilize the TFE3 antibody in anti-VEGF and erythropoietin studies. With its versatility and reliability, the TFE3 antibody is an essential component for various experiments in the field of life sciences.

The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.

Rabbit polyclonal RPS25 antibody (FITC)

CAPN2 antibody was raised in Rabbit using Human CAPN2 as the immunogen

Affinity purified Rabbit polyclonal XPNPEP2 antibody

The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.

The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.

ACTR1B antibody was raised in Rabbit using Human ACTR1B as the immunogen

NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL

QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL

CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.

Rabbit polyclonal SLITRK3 antibody

PRKAR2A antibody was raised in rabbit using the middle region of PRKAR2A as the immunogen

Rabbit polyclonal CHRC1 antibody