Anticorps primaires

The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.

The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.

CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.

Affinity purified Rabbit polyclonal ZNF211 antibody

Affinity purified Chicken polyclonal PRPH antibody

Rabbit polyclonal AQP2 antibody (Ser264)

CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.

Rabbit polyclonal TRPC4AP antibody

Rabbit polyclonal WBSCR17 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The metabolism of this drug involves several transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal PRKCG antibody

Complement C3b beta antibody was raised in mouse using human complement component C3 as the immunogen.

GCK antibody was raised in rabbit using the N terminal of GCK as the immunogen

TBC1D16 antibody was raised using the middle region of TBC1D16 corresponding to a region with amino acids RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF

Rabbit polyclonal Beta Enolase antibody (FITC)

The RANKL antibody is a monoclonal antibody that targets the receptor activator of nuclear factor-kappa B ligand (RANKL). It is used in the field of life sciences to study various biological processes, including microvessel density and growth factor signaling. The RANKL antibody has been shown to have an acidic pH optimum and can be used in combination with other antibodies such as adalimumab or anticoagulants for research purposes. This antibody is commonly used in immunohistochemistry and Western blotting techniques to detect the presence of RANKL in different tissues or cell types. It has also been used in studies investigating the role of RANKL in diseases such as osteoporosis, cancer, and multidrug resistance.

ARSA antibody was raised in Rabbit using Human ARSA as the immunogen

PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive studies have demonstrated its effectiveness on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.