Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
PPEF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.Goat anti Human IgG (Fab'2) (PE)
Goat anti-human IgG (Fab'2) (PE) was raised in goat using human IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%Delangin B antibody
Delangin B antibody was raised in Rat using Delangin peptide coupled carrier protein as the immunogen.
Factor VIII antibody (HRP)
Factor VIII antibody (HRP) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.
Met antibody
Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.
Degré de pureté :Min. 95%IL3 antibody
IL3 antibody was raised in rabbit using highly pure recombinant murine IL-3 as the immunogen.
Degré de pureté :Min. 95%SLC1A5 antibody
SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
