Anticorps primaires

GMPPB antibody was raised in Rabbit using Human GMPPB as the immunogen

Apelin Receptor antibody is a monoclonal antibody that specifically targets the apelin receptor, a G-protein coupled receptor involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to alpha-fetoprotein, acidic androgen protein, autoantibodies, lysozyme, leukemia inhibitory factor, glycosylation, arginase, and other related factors. The Apelin Receptor antibody is widely used as a research tool for studying the role of apelin signaling pathways and its potential therapeutic applications. With its high specificity and inhibitory effects on apelin receptor activation, this antibody offers valuable insights into understanding the complex mechanisms underlying various biological processes.

VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Rabbit polyclonal GABRB3 antibody (Ser408/409)

PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK

The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.

Mouse monoclonal CXCR1 antibody

The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.

ACSS1 antibody was raised in Rabbit using Human ACSS1 as the immunogen

CTNNB1 antibody was raised in rabbit using the C terminal of CTNNB1 as the immunogen

GIMAP2 antibody was raised in Rabbit using Human GIMAP2 as the immunogen

Rabbit polyclonal PPP1R11 antibody (FITC)

The Tau antibody is a medicament that belongs to the class of globulin-based drugs. It is a polyclonal antibody that has been specifically designed to target and neutralize the activity of Tau protein. Tau protein plays a crucial role in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, by forming abnormal aggregates in the brain.

Affinity purified Mouse polyclonal FABP2 antibody

The NGAL antibody is a glycoprotein that specifically targets a polypeptide found in mesenchymal stem cells. It is a Monoclonal Antibody that has been developed using adeno-associated virus (AAV) technology. This antibody has neutralizing properties, meaning it can block the activity of the target polypeptide and prevent its function. The NGAL antibody can be used for various applications, including research in the field of Life Sciences, as well as for therapeutic purposes. It is produced through a hybridoma cell line and can be conjugated with maleimide or other molecules to enhance its specificity or functionality. Additionally, this antibody has shown antiviral properties and may have potential applications in the treatment of viral infections.

Rabbit polyclonal RASD2 antibody

SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG