Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
Sheep anti Rabbit IgG (H + L) (Alk Phos)
Sheep anti-rabbit IgG (H+L) (Alk Phos) was raised in sheep using rabbit IgG whole molecule as the immunogen.Degré de pureté :Min. 95%CD86 antibody (Spectral Red)
CD86 antibody (Spectral Red) was raised in rat using murine CD86 as the immunoge.
Degré de pureté :Min. 95%Calreticulin antibody
Calreticulin antibody is a polyclonal antibody that acts as an inhibitor of growth factors. It specifically targets low-density lipoprotein receptors and alpha-synuclein, two molecules that play a crucial role in cellular growth and development. Additionally, this antibody has been shown to bind to epidermal growth factor and trastuzumab, both monoclonal antibodies used in cancer treatment. By binding to these molecules, the calreticulin antibody prevents their interaction with nucleotide molecules, inhibiting nuclear signaling and ultimately suppressing cell growth. Furthermore, it exhibits anti-HER2 activity by blocking the amino group of epidermal growth factor receptors. With its multifaceted mechanisms of action, the calreticulin antibody holds promise for various therapeutic applications.
USP22 antibody
USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD
ABCB1 antibody
ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%HES1 antibody
The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.
