Anticorps primaires

Rabbit Polyclonal alpha Catenin antibody (Ser641)

The Angiotensin II antibody is a powerful tool in the field of immunology. It is an antibody specifically designed to target and bind to angiotensin II, a hormone involved in regulating blood pressure and fluid balance in the body. This antibody can be used for various applications, including research studies, diagnostic tests, and therapeutic interventions.

The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.

The KLK5 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as an inhibitor of endothelial growth factor, acidic neurotrophic factor, and colloidal antibodies. Additionally, it has neutralizing properties against glucagon and tyrosine growth factor.

RAB8A antibody was raised in rabbit using the middle region of RAB8A as the immunogen

Affinity purified Rabbit polyclonal MTMR2 antibody

The p27 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets c-myc, antiphospholipid antibodies, autoantibodies, fibrinogen, superoxide, antibodies, tyrosine, ribosomal binding, alpha-synuclein, Polyclonal Antibodies, collagen, and anticoagulant. This antibody plays a crucial role in various research applications such as immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA).

EEF1G antibody was raised using the N terminal of EEF1G corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

FXYD4 antibody was raised in Rabbit using Human FXYD4 as the immunogen

BVES antibody was raised in Rabbit using Human BVES as the immunogen

Rabbit polyclonal PKC alpha beta 2 antibody

R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Rabbit polyclonal SH3PXD2A antibody

The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.

PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Mouse monoclonal ZFAND2B antibody

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.