Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
UBE2L3 antibody
UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
PNMT antibody
The PNMT antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of norepinephrine, a neurotransmitter involved in various physiological processes.
GCLM antibody
GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
CD68 antibody
The CD68 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD68, a glycoprotein that is expressed on the surface of activated macrophages, adipose tissue cells, and certain types of collagen. This antibody is widely used in research and diagnostic applications to detect the presence of CD68 in various biological samples, such as human serum or tissues.
EpCAM antibody
The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.
Mouse anti Human Kappa Light Chain antibody
Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.
Caspase 6 antibody
The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.
