Anticorps primaires

<p>PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG</p>

<p>Rabbit Polyclonal cJun antibody</p>

<p>LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT</p>

<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>

<p>Rabbit polyclonal NFKP p65 antibody (Ser311)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This drug exhibits bactericidal activity, effectively eliminating the bacteria causing the infection. Its mechanism of action involves binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes necessary for bacterial survival. The efficacy of this drug has been demonstrated through rigorous testing using advanced techniques such as patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations in the body, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranos</p>

<p>FZD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI</p>

<p>PSMC6 antibody was raised in rabbit using the C terminal of PSMC6 as the immunogen</p>

<p>SOX5 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 5</p>

<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

<p>SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI</p>

<p>UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL</p>

<p>The EXO1 antibody is a highly specific and sensitive polyclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to detect and target a variety of proteins, making it an essential tool in many research applications. This antibody has been extensively tested and validated, ensuring reliable and accurate results.</p>

<p>Rabbit Polyclonal MAPKAPK2 antibody (Thr222)</p>

<p>ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>OR2L8 antibody was raised in rabbit using the C terminal of OR2L8 as the immunogen</p>

<p>Rabbit polyclonal CKI gamma antibody</p>

<p>RPA4 antibody was raised using the C terminal of RPA4 corresponding to a region with amino acids HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD</p>

<p>Ku80 antibody was raised in rabbit using residues 419-440 [LVYVQLPFMEDLRQYMFSSLKN] of the 80 kDa Ku80 protein as the immunogen.</p>