Anticorps primaires

Rabbit polyclonal PLD1 antibody (Ser561)

Rabbit polyclonal PSMG2 antibody

Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.

CD70 antibody was raised in rabbit using the N terminal of CD70 as the immunogen

FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY

ASPA antibody was raised in Rabbit using Human ASPA as the immunogen

Rabbit polyclonal RPS26 antibody

PTGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE

The Anti-HIV p24 antibody is a powerful tool in the fight against HIV. This monoclonal antibody specifically targets the p24 protein, which is an essential component of the HIV virus. By binding to this protein, the antibody prevents the virus from replicating and spreading throughout the body. In addition to its antiviral properties, the Anti-HIV p24 antibody has been shown to have other beneficial effects. It has been found to inhibit epidermal growth factor signaling, which is involved in cell proliferation and survival. This can help prevent the spread of cancer cells and may have potential applications in cancer treatment. Furthermore, studies have shown that this antibody can enhance the effectiveness of other targeted therapies, such as trastuzumab for HER2-positive breast cancer. By combining these treatments, researchers have observed improved outcomes and increased patient survival rates. The Anti-HIV p24 antibody also has potential diagnostic applications. It can be used in laboratory tests to detect the presence of HIV infection by binding

Luteinizing hormone beta antibody was raised in mouse using human LH as the immunogen.

Mouse monoclonal STAT4 antibody

The Phospholamban antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize phospholamban, an inhibitory factor involved in the regulation of calcium uptake and release in cardiac muscle cells. This antibody has been extensively tested and shown to effectively lyse phospholamban-expressing cells, making it a valuable tool for researchers studying the role of phospholamban in various physiological processes. Additionally, this antibody has also been found to have neutralizing effects on certain autoantibodies, such as antiphospholipid antibodies, and can modulate the activity of colony-stimulating factors like GM-CSF. With its high specificity and potency, the Phospholamban antibody is an essential component for any research project involving phospholamban or related proteins.

The TFE3 antibody is a polyclonal antibody that specifically targets the beta-hairpin region of the TFE3 protein. This antibody is widely used in life sciences research, particularly in assays related to growth factors, insulin, and inhibitors. The TFE3 antibody has been shown to effectively detect and neutralize superoxide, making it a valuable tool for studying oxidative stress-related processes. Additionally, this antibody has demonstrated cytotoxic effects against cancer cells expressing high levels of c-myc and endothelial growth factors. Researchers also utilize the TFE3 antibody in anti-VEGF and erythropoietin studies. With its versatility and reliability, the TFE3 antibody is an essential component for various experiments in the field of life sciences.

Affinity purified Rabbit polyclonal Collagen I alpha 2 antibody

Affinity purified Rabbit polyclonal DJA1 antibody

Mouse monoclonal CDK5 antibody (N-terminus)

ACTR1B antibody was raised in Rabbit using Human ACTR1B as the immunogen

NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL

QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL