Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.709 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(738 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75327 produits trouvés pour "Anticorps primaires"
OR13C9 antibody
OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen
Degré de pureté :Min. 95%IL1 beta antibody
The IL1 beta antibody is a monoclonal antibody that specifically targets and binds to IL1 beta, an inflammatory cytokine involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It has been found to inhibit the activation of IL1 beta, leading to a reduction in inflammation and associated symptoms.
Carbonic Anhydrase I antibody
Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS
Trx antibody
The Trx antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the growth hormone receptor, allowing for accurate detection and analysis of this important protein. The Trx antibody has been extensively tested and validated for its effectiveness in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). With its high affinity and specificity, the Trx antibody provides reliable and reproducible results in detecting growth hormone receptor expression in human serum samples. Additionally, this antibody has been shown to be effective in identifying autoantibodies and chemokines involved in interferon signaling pathways. Its unique characteristics make the Trx antibody an essential tool for researchers investigating the role of growth hormone receptor activation in various biological processes.
APP antibody
The APP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to amyloid precursor protein (APP), which plays a crucial role in the development of Alzheimer's disease. This antibody has been extensively tested and proven to have high specificity and sensitivity for detecting extracellular histones, collagen, and other proteins involved in various biological processes.
BMX antibody
The BMX antibody is a powerful tool for researchers in the field of molecular biology. It is an antibody that specifically targets and binds to the BMX protein, a member of the tyrosine kinase family. This antibody can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.
