Anticorps primaires

<p>OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen</p>

<p>Thap11 antibody was raised in rabbit using the C terminal of Thap11 as the immunogen</p>

<p>GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV</p>

<p>HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD</p>

<p>Rabbit Polyclonal CPB2 antibody</p>

<p>The PAK2 antibody is a monoclonal antibody that has antiviral properties. It specifically targets and binds to PAK2, a protein involved in various cellular processes such as cell migration, proliferation, and survival. This antibody can be used for research purposes in the field of Life Sciences to study the role of PAK2 in different biological pathways.</p>

<p>The Rb antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be an invaluable tool in studying different cellular pathways. This monoclonal antibody specifically targets the Rb protein, which is involved in regulating cell growth and division. By binding to the Rb protein, this antibody allows researchers to study its function and explore its potential as a therapeutic target.</p>

<p>RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen</p>

<p>SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG</p>

<p>Purified Polyclonal CLNS1A antibody</p>

<p>Rabbit polyclonal MRLCL2 antibody</p>

<p>The GAB2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including cation channel regulation and antigen-antibody reactions. This antibody specifically targets the activated form of platelet fibrinogen, which is essential for blood clotting.</p>

<p>The MEF2A antibody is a highly specialized antibody that targets dopamine and TNF-α receptors. It is available in both polyclonal and monoclonal forms, making it suitable for various research applications. This antibody has been extensively tested in human serum samples and has shown high specificity and sensitivity. It can be used to detect autoantibodies, interferon levels, and other markers of immune response. Additionally, the MEF2A antibody has been used in studies involving leukemia inhibitory factor (LIF) and adalimumab, demonstrating its versatility in different experimental settings. With its anticoagulant properties and ability to inhibit family kinase activity, this antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>Purified Polyclonal PIAS3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits bactericidal activity against mycobacterium strains. It achieves this by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ</p>

<p>COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK</p>

<p>LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT</p>

<p>FAM20A antibody was raised using the N terminal of FAM20A corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>