Anticorps primaires

<p>The STAT5B antibody is a highly specialized product used in the field of Life Sciences. It is designed to specifically target and inhibit the activity of STAT5B, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and validated for its effectiveness in blocking the function of STAT5B.</p>

<p>The CD71 antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody specifically targets the CD71 molecule, also known as transferrin receptor 1. It plays a crucial role in iron metabolism and is highly expressed on the surface of proliferating cells.</p>

<p>The Caspase 2 antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to target and detect caspase 2, an enzyme involved in cell apoptosis. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various cellular processes.</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.</p>

<p>The NMDAR1 antibody is a diagnostic reagent that belongs to the class of antibodies. It has excellent pharmacokinetic properties and is commonly used in Life Sciences research. The antibody is designed to specifically bind to NMDAR1, a biomolecule involved in various cellular processes such as synaptic plasticity and learning. It can be used for applications such as immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal CTDSP1 antibody</p>

<p>The nNOS antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>The GluR1 antibody is a polyclonal antibody that is used in Life Sciences research. It has been specifically designed to detect and bind to the GluR1 receptor, which is an ionotropic glutamate receptor involved in synaptic transmission. This antibody can be used in various applications, such as electrochemical impedance spectroscopy and transcription-polymerase chain reaction (PCR), to study the function and expression of the GluR1 receptor. Additionally, it can be used in agglutination assays to measure the interaction between the GluR1 receptor and other molecules, such as glycine or gamma-aminobutyric acid (GABA). The GluR1 antibody has high specificity and affinity for its target, making it a valuable tool for researchers studying neuronal signaling pathways and synaptic plasticity. Furthermore, this antibody has shown antioxidant activity and may have potential therapeutic applications in neurodegenerative diseases.</p>

<p>Purified Rabbit polyclonal PUB69 antibody</p>

<p>The GATA1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and inhibitors, specifically designed to target and neutralize GATA1 protein. This monoclonal antibody has been extensively studied and proven to be highly effective in various applications.</p>

<p>Purified Polyclonal MKK1 antibody</p>

<p>Purified rabbit polyclonal SLC8A1 antibody</p>

<p>DCDC2 antibody was raised using the middle region of DCDC2 corresponding to a region with amino acids KGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS</p>

<p>HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Rabbit polyclonal CRP antibody (Prediluted for IHC)</p>

<p>Purified Polyclonal SENP5 antibody</p>

<p>The Tyrosine Hydroxylase antibody is a highly specific antibody that binds to tyrosine hydroxylase, an enzyme involved in the synthesis of neurotransmitters such as dopamine and norepinephrine. This antibody is widely used in Life Sciences research to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.</p>