Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.621 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
eIF2 alpha antibody
The eIF2 alpha antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the protein eIF2 alpha, which plays a crucial role in cellular processes such as translation initiation. By blocking the activity of eIF2 alpha, this antibody can be used to study its function and regulation in various biological systems.
Degré de pureté :Min. 95%TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Degré de pureté :Min. 95%p73 antibody
The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.
Degré de pureté :Min. 95%CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
Cdc25C antibody
Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.
RAVER2 antibody
RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL
Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
EWSR1 antibody
EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
H+K+ ATPase antibody
H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.
NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
