Anticorps primaires

<p>ZC3H14 antibody was raised using the N terminal of ZC3H14 corresponding to a region with amino acids KFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKG</p>

<p>Purified Rabbit polyclonal ATP1 alpha antibody (Ser23)</p>

<p>The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.</p>

<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>

<p>Rabbit Polyclonal KRCC1 antibody</p>

<p>Rabbit polyclonal LHR2A antibody</p>

<p>FAM20A antibody was raised using the N terminal of FAM20A corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF</p>

<p>The Mad2L1 Antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the Mad2L1 protein, which plays a crucial role in cell division and growth regulation. This antibody is buffered and optimized for maximum stability and performance.</p>

<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>

<p>ZNF724P antibody was raised in rabbit using the N terminal of ZNF724P as the immunogen</p>

<p>RGD1307041 antibody was raised in rabbit using the middle region of RGD1307041 as the immunogen</p>

<p>Rabbit polyclonal ELOVL3 antibody</p>

<p>The ZFP36L1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the ZFP36L1 protein, which plays a crucial role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL</p>

<p>RTN3 antibody was raised in Mouse using a purified recombinant fragment of RTN3 expressed in E. coli as the immunogen.</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

<p>Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids HELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP</p>

<p>Purified Polyclonal NEFL antibody</p>

<p>FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHI</p>

<p>DHRS2 antibody was raised in Rabbit using Human DHRS2 as the immunogen</p>