Anticorps primaires

Purified Rabbit polyclonal NDUFA4 antibody

The VTA1 antibody is a monoclonal antibody that has been developed for use in chemotherapy. It specifically targets tumor-related macrophages and works by inhibiting the production of interleukin, a protein that promotes tumor growth. The VTA1 antibody can also bind to autoantibodies and antibodies present in the body, thereby reducing their activity and preventing them from attacking healthy cells. Additionally, this antibody recognizes specific glycans on the surface of cancer cells, making it an effective tool in Life Sciences research. It has also shown antiviral properties and can be used in the development of new treatments for viral infections. The VTA1 antibody is available as both a monoclonal and polyclonal form, allowing researchers to choose the option that best suits their needs. With its ability to target antigens extracellularly and withstand high-flux irradiation, this antibody is a valuable asset in the field of cancer research and treatment.

Rabbit polyclonal SIK antibody

TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids TDGSLKNGFPGEETHGLGGEKALETCGAGRSESEVIAEGKAEDVKPEECA

CD90.2 antibody (Spectral Red) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.

The Lp-PLA2 monoclonal antibody is a powerful growth factor that targets specific proteins involved in the regulation of collagen and fatty acid metabolism. This antibody is designed to bind to Lp-PLA2, an enzyme responsible for the production of inflammatory mediators. By inhibiting this enzyme, the monoclonal antibody reduces inflammation and promotes healthy tissue repair.

Rabbit polyclonal SULT2A1 antibody

PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV

Rat monoclonal CD5 antibody (allophycocyanin)

Armenian Hamster monoclonal CD61 antibody (biotin)

The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.

The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.

FITC antibody (biotin) was raised in goat using fluorescein conjugated to goat IgG as the immunogen.

Goat anti-rat IgG (H+L) (Fab'2) (FITC) was raised in goat using rat IgG whole molecule as the immunogen.

ETV1 antibody was raised in rabbit using the N terminal of ETV1 as the immunogen

GOT2 antibody was raised in Rabbit using Human GOT2 as the immunogen

ATP13A1 antibody was raised in Rabbit using Human ATP13A1 as the immunogen