Anticorps primaires

Affinity purified Rabbit polyclonal CHEK2 antibody

Rabbit polyclonal SERPINH1 antibody

Affinity purified Rabbit polyclonal DCSIGN antibody

ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.

Rat monoclonal BP1 antibody (PE)

The IGFBP2 antibody is a cytotoxic monoclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and neutralize IGFBP2, a protein involved in cellular processes such as cell growth and proliferation. This antibody has been shown to be highly effective in inhibiting the activity of IGFBP2, making it a valuable tool for researchers studying the role of this protein in different biological systems.

The IGF1 antibody is a highly specialized antibody that targets insulin-like growth factor 1 (IGF1). It plays a crucial role in various physiological processes, including cell growth, proliferation, and differentiation. This monoclonal antibody specifically binds to IGF1, inhibiting its activity and preventing it from binding to its receptor.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

LDB1 antibody was raised in Rabbit using Human LDB1 as the immunogen

The SOCS3 antibody is a highly specific monoclonal antibody that has been developed for use in the field of life sciences. It is used to target and neutralize IL-17A, a cytokine involved in inflammatory responses. This specific antibody can be used in various applications, including as a therapeutic agent or as a research tool for studying IL-17A-mediated signaling pathways.

Rotavirus antibody was raised in mouse using p42 inner-capsid rotavirus antigen as the immunogen.

Rabbit polyclonal APP antibody (biotin)

Affinity purified Rabbit polyclonal FBXL12 antibody

The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.

PDE1B antibody was raised in rabbit using the middle region of PDE1B as the immunogen

The CD40L antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and neutralize the CD40 ligand, which is involved in various autoimmune and inflammatory diseases. This antibody has been extensively studied for its ability to inhibit the production of autoantibodies, such as antiphospholipid antibodies, and regulate the immune response.

Affinity purified Rabbit polyclonal BAIAP2L1 antibody