Anticorps primaires

<p>FGF17 antibody was raised in goat using highly pure recombinant human FGF-17 as the immunogen.</p>

<p>Rabbit polyclonal CD225 antibody (biotin)</p>

<p>The GFR antibody is a highly specialized antibody used in the field of Life Sciences. It can be either polyclonal or monoclonal, depending on the specific application. This antibody has neutralizing properties and is designed to target and bind to chemokines, which are low-molecular-weight proteins involved in cell signaling. The GFR antibody can also interact with growth factors such as TGF-beta and EGF-like proteins, inhibiting their activity.</p>

<p>Rabbit polyclonal ES8L1 antibody</p>

<p>Rabbit polyclonal OR8J3 antibody</p>

<p>The NF kappaB p65 antibody is a polyclonal antibody that has proapoptotic effects. It is commonly used as an nf-kappab inhibitor in various biological assays. This antibody specifically targets the p65 subunit of the NF kappaB protein, which plays a crucial role in regulating gene expression and immune responses. By inhibiting the activity of NF kappaB, this antibody can induce apoptosis in cells and modulate various cellular processes.</p>

<p>The SCNN1A antibody is a highly effective inhibitor that targets β-catenin, an essential protein involved in various cellular processes. This antibody is widely used in the Life Sciences field for research purposes and has shown significant potential as a therapeutic agent. It acts as an HDAC inhibitor, inhibiting histone deacetylase activity and promoting gene expression. Additionally, the SCNN1A antibody exhibits potent inhibitory effects on methyl transferase and 6-phosphogluconate dehydrogenase enzymes, which are crucial for cell metabolism.</p>

<p>BEX2 antibody was raised in Rabbit using Human BEX2 as the immunogen</p>

<p>Rabbit polyclonal Synaptophysin antibody (Prediluted for IHC)</p>

<p>Purified Rabbit polyclonal MADS91 antibody</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>The MASH1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits the growth factor MASH1. This antibody has been extensively studied and proven to be highly effective in blocking the activity of MASH1, making it an invaluable tool for researchers studying the role of this growth factor in various biological processes.</p>

<p>TBRG1 antibody was raised in rabbit using the N terminal of TBRG1 as the immunogen</p>

<p>ZC3H14 antibody was raised using the N terminal of ZC3H14 corresponding to a region with amino acids KFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKG</p>

<p>The JAK2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes. The JAK2 antibody has been extensively studied for its ability to inhibit the activation of JAK2 and downstream signaling pathways, including the β-catenin pathway. This inhibition can have significant implications in liver microsomes, collagen synthesis, growth factor signaling, oncostatin M-induced gene expression, calmodulin-dependent kinase activity, and more.</p>

<p>PRRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILL</p>

<p>EIF2B1 antibody was raised using the C terminal of EIF2B1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>Purified Rabbit polyclonal TOB1 antibody</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>