Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
alpha Synuclein antibody
The alpha Synuclein antibody is a valuable tool in Life Sciences research. This antibody specifically targets and inhibits the activity of alpha-synuclein, a protein that plays a crucial role in neurodegenerative diseases such as Parkinson's disease. The antibody has been extensively tested and validated for its efficacy in human serum samples. It effectively neutralizes the activated form of alpha-synuclein, preventing its interaction with other proteins and mitigating its toxic effects on neurons.Degré de pureté :Min. 95%HGF antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Pneumolysin antibody
Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.
Degré de pureté :Min. 95%CSNK1G1 antibody
CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen
Degré de pureté :Min. 95%CD62E antibody (PE)
CD62E antibody (PE) was raised in mouse using human CD62E/E-selectin as the immunogen.
Degré de pureté :Min. 95%ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLDegré de pureté :Min. 95%MDM1 antibody
MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE
Degré de pureté :Min. 95%Lectin antibody
Lectin antibody was raised in rabbit using jack bean concanavalin A lectin as the immunogen.Degré de pureté :Min. 95%Donkey anti Mouse IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Degré de pureté :Min. 95%Rabbit anti Human IgG (Fc) (Agarose Conjugated)
Rabbit anti human IgG (Fc) (Agarose Conjugated) was raised in rabbit using human IgG F(c) fragment as the immunogen.
Degré de pureté :Min. 95%CD44 antibody
The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.
