Anticorps primaires

<p>Purified Rabbit polyclonal MGST3 antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The STAT5B antibody is a highly specialized product used in the field of Life Sciences. It is designed to specifically target and inhibit the activity of STAT5B, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and validated for its effectiveness in blocking the function of STAT5B.</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>Rabbit polyclonal BLCAP antibody</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>Purified Polyclonal DNAJB11 antibody</p>

<p>Rabbit polyclonal Girdin antibody (Ser1417)</p>

<p>Factor IX antibody (HRP) was raised in goat using human Factor IX purified from plasma as the immunogen.</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal KCNC4 antibody</p>

<p>Purified Polyclonal Alpha actin 3 antibody</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>