Anticorps primaires

ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen

HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT

CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.

The EGFR antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is used as a diagnostic reagent in the field of life sciences to detect and measure the levels of EGFR protein biomarkers. This antibody specifically recognizes and binds to EGFR, inhibiting its activation and downstream signaling pathways. By blocking the interaction between EGFR and its ligands, such as epidermal growth factor, the antibody effectively inhibits cell proliferation and survival. The EGFR antibody has been extensively studied for its potential therapeutic applications in cancer treatment, particularly in tumors that overexpress EGFR. Additionally, this antibody has shown promising results in preclinical studies as a potential nephrotoxic agent due to its ability to inhibit hydroxylase activity. Overall, the EGFR antibody is a valuable tool for researchers and clinicians in studying and targeting EGFR-related diseases.

CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.

Rabbit polyclonal MAP3K1 antibody (biotin)

Rabbit polyclonal PPIA antibody (FITC)

PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

TSH beta antibody was raised against Human TSH (intact).

Rabbit polyclonal BTK antibody (Tyr223)

Rabbit polyclonal STARD5 antibody

Rabbit polyclonal RNF10 antibody

GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal SNX19 antibody