Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
KCNQ2 antibody
KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
CD11b antibody (PE)
CD11b antibody (PE) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molChromogranin A antibody
Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.
Caveolin 1 antibody
The Caveolin 1 antibody is a highly specialized monoclonal antibody that targets tyrosine residues on the Caveolin 1 protein. This protein plays a crucial role in cellular processes such as growth factor signaling and receptor internalization. By binding to Caveolin 1, this antibody inhibits its function, leading to cytotoxic effects on cancer cells.
Degré de pureté :Min. 95%Amphetamine antibody
Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.DAPK3 antibody
The DAPK3 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of DAPK3, a chemokine-activated serine/threonine kinase. This antibody has been extensively tested and proven to effectively inhibit the function of DAPK3 in various experimental settings.
C1R antibody
The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.
Goat anti Rabbit IgG (H + L) (Fab'2) (HRP)
Goat anti-rabbit IgG (H+L) (Fab'2) (HRP) was raised in goat using rabbit IgG, whole molecule as the immunogen.
Degré de pureté :Min. 95%PRSS21 antibody
PRSS21 antibody was raised in rabbit using the N terminal of PRSS21 as the immunogen
Degré de pureté :Min. 95%IFI44L antibody
IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
