Anticorps primaires

AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGG

The MUC1 antibody is a highly specialized monoclonal antibody that targets the MUC1 glycoprotein. This glycoprotein plays a crucial role in various biological processes, including cell adhesion, signal transduction, and immune response modulation. The MUC1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to helicobacter infection, erythropoietin receptor signaling, epidermal growth factor regulation, and collagen synthesis.

Mouse monoclonal GBA3 antibody

Rabbit polyclonal MUNC18a antibody (Ser313)

Purified Rabbit polyclonal MARCH2 antibody

Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal OR8J3 antibody

Monoclonal Mouse anti-FLAG-Tag (TM) Antibody recognizes N-terminal, C-terminal or internal DYKDDDDK-tagged fusion proteins. Validated for use in Western Blot and ELISA assays.

Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Affinity purified Rabbit polyclonal XPR1 antibody

HSV1/HSV2 antibody (HRP) was raised in rabbit using Strain F# as the immunogen.

Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

RSV antibody (biotin) was raised in goat using human RSV isolate as the immunogen.

ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS

Please enquire for more information about Affinity Purified anti-V5 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Rabbit polyclonal SLC25A31 antibody

Rabbit polyclonal NFKP p105/p50 antibody (Ser932)

Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.