Anticorps primaires

<p>The IL8 antibody is a polyclonal antibody used in the field of life sciences. It specifically targets alpha-fetoprotein and is known for its neutralizing properties. This antibody is commonly used in research and diagnostic applications. It has been extensively studied and proven to be effective in blocking the activity of TGF-beta, a growth factor involved in various cellular processes. The IL8 antibody is available as a monoclonal antibody and contains excipients to ensure stability and effectiveness. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is highly specific to its target molecule and has been validated for its accuracy and reliability. Researchers rely on the IL8 antibody to study the role of alpha-fetoprotein in different biological systems and to develop potential therapeutic interventions. With its high affinity and specificity, this monoclonal antibody is an essential tool for studying cell signaling pathways, drug discovery, and understanding disease mechanisms.</p>

<p>Rabbit Polyclonal PIK3R1 antibody (Tyr467)</p>

<p>Rabbit polyclonal CRFR2 antibody</p>

<p>Rabbit polyclonal TPD54 antibody</p>

<p>The cMyc antibody is a highly specialized molecule drug used in Life Sciences research. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and apoptosis. This antibody specifically targets the cMyc protein, which is involved in regulating gene expression.</p>

<p>Rabbit polyclonal ZNF265 antibody</p>

<p>Purified Polyclonal HKR1 antibody</p>

<p>The Ezrin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to ezrin, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathways, particularly endothelial growth factor (EGF). By blocking EGF signaling, the Ezrin antibody can prevent the proliferation and migration of cells, making it an ideal choice for research and therapeutic applications.</p>

<p>EIF4G3 antibody was raised using the N terminal of EIF4G3 corresponding to a region with amino acids TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIA</p>

<p>The Estrogen Receptor alpha antibody is a monoclonal antibody that specifically targets the estrogen receptor alpha protein. This antibody has been extensively studied and shown to have neutralizing properties against the estrogen receptor alpha, which plays a crucial role in various physiological processes such as adipose tissue development and regulation.</p>

<p>Rabbit Polyclonal ABL1/2 antibody (Tyr393/429)</p>

<p>Rabbit polyclonal MRPL4 antibody</p>

<p>PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY</p>

<p>The Survivin antibody is a colloidal polyclonal antibody that is used in the field of Life Sciences. It acts as an inhibitor of tumor necrosis factor-alpha (TNF-α) and plays a crucial role in regulating cell division and apoptosis. This antibody specifically targets survivin, a protein that belongs to the inhibitor of apoptosis (IAP) family. By neutralizing survivin, this antibody prevents its interaction with other proteins involved in cell survival and growth, such as hepatocyte growth factor and epidermal growth factor. Additionally, the Survivin antibody has been shown to have cytotoxic effects on cancer cells by inhibiting their proliferation and inducing cell death. This makes it a valuable tool for researchers studying various diseases and exploring potential therapeutic strategies.</p>

<p>FMNL1 antibody was raised in mouse using recombinant Human Formin-Like 1</p>

<p>The LATS antibody is a polyclonal antibody that is used in life sciences research. It specifically targets alpha-fetoprotein, telomerase, chemokines, brain natriuretic peptide, and growth factor-1 receptor. This antibody is widely used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to be highly specific and sensitive in detecting its target proteins in human serum samples. The LATS antibody can be used to study the role of these proteins in various physiological processes and diseases. With its high-quality performance and reliable results, this antibody is an essential tool for researchers in the field of life sciences.</p>

<p>RAD51AP1 antibody was raised using the middle region of RAD51AP1 corresponding to a region with amino acids IKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSL</p>

<p>The NF1 antibody is a polyclonal antibody that specifically targets the NF1 protein. This protein plays a crucial role in regulating cell growth and division, as well as in controlling the development of tumors. The NF1 antibody is widely used in life sciences research to study the function and activity of the NF1 protein.</p>

<p>Rabbit polyclonal KCNJ5 antibody</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>