CymitQuimica logo
Anticorps primaires

Anticorps primaires

Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.

Sous-catégories appartenant à la catégorie "Anticorps primaires"

Affichez 1 plus de sous-catégories

75326 produits trouvés pour "Anticorps primaires"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • CD298 antibody


    <p>The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-51459

    Produit arrêté
  • LARGE antibody


    <p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-6856

    Produit arrêté
  • Myeloperoxidase antibody


    <p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>
  • LIN7C antibody


    <p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

    Ref: 3D-70R-18280

    Produit arrêté
  • CPA1 antibody


    <p>The CPA1 antibody is a monoclonal antibody that specifically targets the CPA1 enzyme. This antibody has been extensively studied for its protease activity and its potential applications in the field of life sciences. It has been shown to effectively inhibit the activity of CPA1, which plays a crucial role in various physiological processes.</p>

    Ref: 3D-10R-6857

    Produit arrêté
  • H+K+ ATPase antibody


    <p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

    Ref: 3D-10R-H100B

    Produit arrêté