Anticorps primaires

Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ

Affinity purified Rabbit polyclonal GADD45 gamma antibody

APBB2 antibody was raised in Rabbit using Human APBB2 as the immunogen

DIDO1 antibody was raised in Rabbit using Human DIDO1 as the immunogen

Rabbit polyclonal ADCY7 antibody

CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Affinity purified Rabbit polyclonal USP47 antibody

Rabbit polyclonal TNAP1 antibody

Affinity purified Rabbit polyclonal STRA8 antibody

ARL8B antibody was raised in Rabbit using Human ARL8B as the immunogen

Affinity purified Rabbit polyclonal Serpina 4 antibody

Affinity purified Rabbit polyclonal PTPN11 antibody

Rabbit polyclonal HNRPH1 antibody

The COX2 antibody is a powerful tool used in immunoassay tests to detect the presence of cyclooxygenase-2 (COX-2) protein. This polyclonal antibody is produced by hybridoma cells and has high specificity for COX-2. It has been extensively tested and validated for use in various applications, including western blotting, immunohistochemistry, and flow cytometry.

The CMTM6 antibody is a hormone peptide that binds to specific proteins in the body. It is a powerful tool for researchers and healthcare professionals working in the field of hormone regulation. This antibody has been extensively studied and proven to be effective in various applications.

The ALK antibody is a highly effective multidrug that is commonly used in immunoassays. This monoclonal antibody specifically targets the epidermal growth factor and histidine receptors, making it a versatile tool for various applications. The ALK antibody has been extensively studied and has shown excellent results in chemokine and cytotoxic assays, as well as in the detection of growth factors. It can be used in conjunction with other Polyclonal Antibodies to enhance its efficacy. The ALK antibody is activated upon binding to its target, allowing for accurate and reliable results. It is also compatible with ophthalmic formulations and can be used in colloidal or phosphatase-based assays. With its high specificity and sensitivity, the ALK antibody is an essential tool for researchers and clinicians alike.

The Cytoglobin antibody is a polyclonal antibody that has been developed to target the Cytoglobin protein. This protein is involved in various biological processes, including cell growth and differentiation. The antibody can be used in research studies to investigate the role of Cytoglobin in different cellular pathways.

MDR1 antibody is a chemokine that belongs to the group of polyclonal antibodies. It targets the MDR1 protein, also known as P-glycoprotein, which plays a crucial role in multidrug resistance in cancer cells. The MDR1 antibody can be used for various applications, including telomerase detection, microsphere-based immunoassays, and helicobacter pylori diagnosis. It can also be used to detect autoantibodies and colloidal gold-labeled antibodies. Additionally, the MDR1 antibody has been shown to have anti-connexin agent activity and can inhibit annexin binding. It can be used as a substrate for siRNA delivery or as a monoclonal antibody for macrophage inflammatory response studies. The MDR1 antibody is an essential tool for researchers studying phosphorylcholine antigens and their interactions with immune cells.

Enterovirus antibody is a biomolecule that specifically targets the glycoprotein of enteroviruses. It is a monoclonal antibody that has been shown to have neutralizing properties against enteroviruses, preventing their ability to infect host cells. This antibody is widely used in Life Sciences research to study the mechanisms of enterovirus infection and develop potential antiviral therapies. Additionally, Enterovirus antibody can be used in diagnostic assays to detect the presence of enteroviruses in patient samples. Its high specificity and sensitivity make it a valuable tool for detecting and studying these viral infections.