Anticorps primaires

The BACE antibody is a monoclonal antibody that has been specifically designed to target and inhibit the activity of beta-secretase (BACE1). This enzyme plays a crucial role in the production of amyloid-beta peptides, which are believed to be key contributors to the development of Alzheimer's disease. By binding to BACE1, the antibody effectively blocks its activity and prevents the formation of amyloid-beta peptides.

OPRK1 antibody was raised in rabbit using the N terminal of OPRK1 as the immunogen

DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

Armenian Hamster monoclonal PD1 antibody (PE)

CD45.2 antibody (biotin) was raised in mouse using CD45.2 as the immunogen.

AGTRAP antibody was raised in Rabbit using Human AGTRAP as the immunogen

Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen

Rabbit polyclonal UBXN1 antibody

The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.

JUP antibody was raised in Rabbit using Human JUP as the immunogen

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

The VPAC2 antibody is a glycoprotein that acts as an endonuclease. It specifically targets and binds to the VPAC2 receptor, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody is commonly used in life sciences research and has applications in fields such as immunology, cancer research, and drug development.

Affinity purified Rabbit polyclonal ASB9 antibody

Mouse monoclonal C17orf28 antibody

The E2F1 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to the E2F1 protein, which is involved in cell cycle regulation and apoptosis. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The E2F1 antibody has been shown to be effective in detecting the activation of tumor necrosis factor-alpha (TNF-α) and beta-catenin signaling pathways. It can also be used to study adipose tissue development and function. With its high specificity and sensitivity, this antibody is a valuable tool for researchers studying various cellular processes and signaling pathways.

Rabbit polyclonal TNFSF9 antibody (HRP)

Affinity purified Rabbit polyclonal PHKA1 antibody

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.