Anticorps primaires

Rabbit polyclonal USP12 antibody

GNG4 antibody was raised in Rabbit using Human GNG4 as the immunogen

The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.

Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.

Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide

Rabbit polyclonal PEX1 antibody

Mouse monoclonal CD38 antibody (FITC)

CAPRIN2 antibody was raised in Rabbit using Human CAPRIN2 as the immunogen

CD3 antibody (FITC) was raised in Mouse using a purified recombinant fragment of human CD3 expressed in E. coli as the immunogen.

Affinity purified Rabbit polyclonal ARA9 antibody

Rabbit polyclonal Tau antibody (Ser422)

The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this

SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ

The Aromatase antibody is a protein that belongs to the group of Polyclonal Antibodies. It plays a crucial role in the process of glycosylation, which is important for the proper functioning of various biological processes. This antibody can bind to specific targets and help in the detection and analysis of glycoproteins. Additionally, it has been shown to have cholinergic and acetyltransferase activities, making it valuable in research related to neurotransmission and signal transduction. The Aromatase antibody can also be used to detect autoantibodies and phosphatases in biological samples. Furthermore, studies have indicated its involvement in regulating interleukin-6 levels, suggesting its potential role in modulating immune responses. Overall, this monoclonal antibody is an essential tool for researchers in Life Sciences and offers insights into various cellular processes, including genotoxicity and interferon signaling pathways.

ERK2 antibody was raised in Mouse using a purified recombinant fragment of human ERK2 expressed in E. coli as the immunogen.

CD22 antibody (Spectral Red) was raised in rat using CD22 as the immunogen.

Affinity purified Rabbit polyclonal OSGEP antibody