Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
Goat anti Human IgG + IgA + IgM (Alk Phos)
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.
Degré de pureté :Min. 95%CD38 antibody (PE)
CD38 antibody (PE) was raised in rat using CD38 as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD3e antibody (PE)
CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD152 antibody (PE)
CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molFKBP52 antibody
The FKBP52 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to FKBP52, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies, histidine residues, alkaline phosphatases, epidermal growth factor (EGF), transforming growth factor-beta1 (TGF-beta1), and other growth factors.
CD117 antibody (Spectral Red)
CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molNSUN3 antibody
NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP
NANP antibody
NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%Goat anti Rabbit IgG (Alk Phos)
Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%TNF alpha antibody
TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.
Degré de pureté :Min. 95%ADAMTS4 antibody
The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.
