Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
Aromatase antibody
The Aromatase antibody is a protein that belongs to the group of Polyclonal Antibodies. It plays a crucial role in the process of glycosylation, which is important for the proper functioning of various biological processes. This antibody can bind to specific targets and help in the detection and analysis of glycoproteins. Additionally, it has been shown to have cholinergic and acetyltransferase activities, making it valuable in research related to neurotransmission and signal transduction. The Aromatase antibody can also be used to detect autoantibodies and phosphatases in biological samples. Furthermore, studies have indicated its involvement in regulating interleukin-6 levels, suggesting its potential role in modulating immune responses. Overall, this monoclonal antibody is an essential tool for researchers in Life Sciences and offers insights into various cellular processes, including genotoxicity and interferon signaling pathways.
C14ORF21 antibody
C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
RIPK4 antibody
RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN
EGF antibody
The EGF antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF), a key regulator of cell growth and division. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of EGF and its downstream signaling pathways.
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
ADAMTS4 antibody
The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.
