Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
NOSIP antibody
The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.
CD3e antibody (FITC)
CD3e antibody (FITC) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
Degré de pureté :Min. 95%ALDOC antibody
ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
FGF8 antibody
The FGF8 antibody is a highly specific antibody used in Life Sciences research. It is designed to target and bind to FGF8, a protein involved in various cellular processes. This antibody can be used in experiments such as immunohistochemistry, Western blotting, and ELISA assays to detect the presence of FGF8.
VMAT2 antibody
The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.
GST antibody
The GST antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It is widely used in Life Sciences research for various applications. This antibody specifically targets and binds to glutathione S-transferase (GST), a glycoprotein commonly used as a fusion tag in protein purification and detection assays. The GST antibody can be immobilized on an electrode or streptavidin-coated surface for use in immunoassays, electrophoresis, or other experimental techniques. Additionally, this antibody has shown promising results in the treatment and/or prophylaxis of certain diseases, including its potential anti-angiogenesis effects. Its specificity and high affinity make it an invaluable tool for researchers studying GST-related processes or developing diagnostic tests using human serum samples.
NFkB regulatory factor antibody
Rabbit polyclonal NFkB antibody (Regulatory Factor)
Degré de pureté :Min. 95%RTN4IP1 antibody
RTN4IP1 antibody was raised in rabbit using the middle region of RTN4IP1 as the immunogen
CD25 antibody
CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.
PPIF antibody
PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
