Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
MUC13 antibody
The MUC13 antibody is a highly specialized antibody that targets the tyrosine-rich region of the MUC13 protein. It is commonly used in Life Sciences research to study multidrug resistance, glycation processes, and the role of MUC13 in various cellular pathways. This antibody has been shown to interact with key proteins such as E-cadherin, circumsporozoite protein, nuclear β-catenin, and growth factors. Additionally, it has demonstrated cytotoxic activity against specific cell lines and has potential antiviral properties. The MUC13 antibody is available as both polyclonal and monoclonal antibodies, making it a versatile tool for researchers in various fields.
Tau antibody
The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.
Ferritin antibody
The Ferritin antibody is a cytotoxic monoclonal antibody that targets annexin A2, a protein involved in cell growth and signaling. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used for the detection and quantification of ferritin, a key iron storage protein, in biological samples. Additionally, this antibody has been used in research to investigate the role of annexin A2 in insulin regulation, as well as its potential as a therapeutic target for diseases such as cancer. The Ferritin antibody is highly specific and can be easily conjugated with streptavidin or other molecules for different experimental setups. Its high affinity towards annexin A2 makes it an excellent tool for studying the interactions between this protein and other molecules such as growth factors or hormones like glucagon. Researchers can utilize this antibody to explore the mechanisms underlying cellular processes and gain valuable insights into various biological pathways.Clostridium difficile Toxin A antibody
The Clostridium difficile Toxin A antibody is a monoclonal antibody that specifically targets the toxin produced by Clostridium difficile bacteria. This antibody is derived from human proteins and contains specific amino acid residues that have been activated to enhance its binding affinity. It works by neutralizing the effects of the toxin, which includes damaging the intestinal lining and causing inflammation.
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to alkaline phosphatase, an enzyme that plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.
Annexin I antibody
The Annexin I antibody is a valuable tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be highly effective in a variety of applications.
PELI1 antibody
The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.
Ketamine antibody
Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.
Phosphothreonine antibody (biotin)
Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.
STOML1 antibody
The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.
RAGE antibody
The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.
Androgen Receptor antibody
The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.
NGAL antibody
The NGAL antibody is a powerful tool in the field of Life Sciences. It is an adeno-associated antibody that specifically targets and neutralizes the activity of tyrosine, TNF-α, and other activated molecules. This antibody has been extensively studied and proven to be highly effective in various research applications.
Lamin B2 antibody
The Lamin B2 antibody is a highly specialized antibody that targets the phosphorylation site on the lamin B2 protein. This antibody is widely used in Life Sciences research for its ability to detect and study the role of lamin B2 in various cellular processes. Lamin B2 is an important component of the nuclear lamina, which provides structural support to the nucleus and regulates gene expression. By targeting the phosphorylation site on lamin B2, this antibody allows researchers to investigate the impact of phosphorylation on lamin B2 function and its implications in immunomodulation, antinociceptive effects, and pluripotent stem cell differentiation. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in fields such as cell biology, molecular biology, and immunology. Whether you are studying vaccine strains, developing new medicines, or exploring novel therapeutic strategies, the Lamin B2 antibody will be a valuable asset in your research.
CD89 antibody
The CD89 antibody is a monoclonal antibody that has neutralizing properties. It is commonly used in the field of Life Sciences as a diagnostic agent. This antibody specifically targets lipoprotein lipase and angptl3, which are proteins involved in adipose tissue metabolism. By binding to these proteins, the CD89 antibody can help regulate lipid levels and potentially aid in the diagnosis of metabolic disorders. Additionally, this antibody can be used as a diagnostic reagent for detecting collagen activation and cytotoxicity. Its versatility makes it an essential test substance for various research applications in the medical and scientific fields.
WTAP antibody
The WTAP antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It acts as an inhibitory factor, blocking specific protein interactions and pathways. This antibody is produced using state-of-the-art technology and is free from any harmful excipients.
SLC22A17 antibody
The SLC22A17 antibody is a powerful tool used in Life Sciences research for the detection and analysis of cxcl13, a nuclear antigen. This polyclonal antibody has been extensively tested and validated for various applications, including immunohistochemistry and DNA-binding protein studies. It specifically recognizes and binds to the surface glycoprotein expressed by SLC22A17, forming a specific complex that can be visualized using techniques such as impedance spectroscopy. With its high specificity and sensitivity, this monoclonal antibody is an essential component in any research project requiring the detection of SLC22A17. Trust in its reliability and accuracy to advance your scientific endeavors.
NELL2 antibody
NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
TFEB antibody
The TFEB antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the transcription factor EB (TFEB), a protein involved in the regulation of various cellular processes. This antibody has been shown to be effective in detecting TFEB in different tissues and cell types, including adipose tissue. By binding to TFEB, this antibody can help researchers study its role in cellular processes such as autophagy, lysosomal biogenesis, and lipid metabolism.
RAB5A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Rb antibody
The Rb antibody is a highly specialized monoclonal antibody that targets mesenchymal stem cells. It acts as an anti-connexin agent, inhibiting the function of connexin proteins involved in cell communication. Additionally, this antibody has a high affinity for collagen and metal-binding proteins, making it an ideal tool for studying extracellular matrix interactions. The Rb antibody has also been used in research related to thrombotic thrombocytopenic purpura (TTP), a blood disorder characterized by clot formation in small blood vessels. Furthermore, polyclonal antibodies derived from this monoclonal antibody have been developed, allowing for broader applications in the life sciences field. It is important to note that proper handling and storage of this antibody are crucial to avoid contaminants and maintain its efficacy.
IL4 antibody
The IL4 antibody is a multidrug that targets specific proteins in the body. It has been shown to have a significant impact on human hepatocytes, inhibiting the production of alpha-fetoprotein and anti-glial fibrillary acidic protein. This antibody is part of a class of chimeric proteins known as polyclonal antibodies, which are widely used in Life Sciences research. The IL4 antibody also acts as an inhibitor, blocking the activity of certain enzymes and molecules involved in various biological processes. It is commonly conjugated with biotinylation and can be easily detected using streptavidin-based detection systems. With its high specificity and affinity, the IL4 antibody offers great potential for therapeutic applications and further scientific investigations.
Fibrinopeptide A antibody (HRP)
Fibrinopeptide A antibody (HRP) was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.
S100 antibody
The S100 antibody is a highly specific monoclonal antibody that targets collagen and is commonly used in various assays and research studies within the field of Life Sciences. It has been shown to effectively bind to activated collagen, neutralizing its effects and preventing further damage. The S100 antibody also demonstrates strong affinity for other proteins such as tissue transglutaminase, nuclear matrix metalloproteinase, and chemokines, making it a versatile tool for studying protein-protein interactions. With its high specificity and efficacy, this monoclonal antibody is an essential component in many research applications requiring precise targeting of collagen and related proteins.TOPK antibody
The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the
PMVK antibody
The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.
FASL antibody
The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.
NSF antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The metabolism of this drug involves several transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
TBC1D16 antibody
TBC1D16 antibody was raised using the middle region of TBC1D16 corresponding to a region with amino acids RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF
Fascin 1 antibody
The Fascin 1 antibody is a highly specialized monoclonal antibody that targets and binds to the protein Fascin 1. Fascin 1 is involved in various cellular processes, including cell adhesion, migration, and cytoskeletal organization. This antibody has been extensively studied in Life Sciences research and has shown inhibitory properties against Fascin 1 activity.
Myc antibody
The Myc antibody is a monoclonal antibody that specifically targets the protein Myc. It belongs to the family of kinase inhibitors and is widely used in Life Sciences research. This antibody has shown high affinity for Myc, making it a valuable tool for studying the functions and interactions of this protein.
Desmoglein 3 antibody
Desmoglein 3 antibody was raised in mouse using recombinant human polypeptide Desmoglein 3 as the immunogen.
BTN3A2 antibody
The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.
BRAF antibody
The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.
AC antibody
AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
Endostatin antibody
Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.Degré de pureté :≥85% By Sds-PageCathepsin F antibody
The Cathepsin F antibody is a polyclonal antibody that specifically targets and binds to Cathepsin F, an acidic cysteine protease. Cathepsin F plays a crucial role in various physiological processes, including the degradation of extracellular matrix components such as fibronectin and collagen. This antibody is highly specific and can be used in various life science applications, including immunohistochemistry, Western blotting, and ELISA.
Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.Carbonic Anhydrase I antibody
The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.
TGFBI antibody
TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Salmonella antibody
Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.Calcitonin antibody
Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.
HIV1 gp41 antibody (HRP)
HIV1 gp41 antibody (HRP) was raised in goat using recombinant ectodomain of gp41 as the immunogen.CD62L antibody
The CD62L antibody is a monoclonal antibody that has neutralizing properties against interferon (IFN) and endothelial growth factor. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets CD62L, a cell surface protein involved in leukocyte adhesion and migration. By binding to CD62L, the antibody inhibits the interaction between leukocytes and endothelial cells, thereby reducing inflammation and immune response. Additionally, this antibody has been pegylated to improve its stability and prolong its half-life in circulation. The CD62L antibody is widely utilized in studies related to autoimmunity, cancer, and inflammatory diseases. Its high specificity and efficacy make it an invaluable tool for researchers in various fields.
IFN gamma antibody
IFN gamma antibody is a growth factor that plays a crucial role in the immune response. This antibody specifically targets and neutralizes interferon-gamma, a key cytokine involved in immune regulation. The IFN gamma antibody is produced using advanced techniques such as electrophoresis and lyophilization, ensuring its high purity and stability. It can be used in various research applications in the field of Life Sciences, including immunological studies and cell culture experiments. This monoclonal antibody has been extensively tested for its specificity and potency, making it a reliable tool for researchers studying the role of interferon-gamma in different biological processes. With its high affinity and selectivity, the IFN gamma antibody provides valuable insights into the complex mechanisms of immune activation and regulation.
Ovalbumin antibody
The Ovalbumin antibody is a polyclonal antibody that specifically targets the ovalbumin protein. Ovalbumin is a basic protein found in egg whites and is commonly used in life sciences research as a model antigen. This antibody has been developed to bind to the CD3 receptor, which is expressed on T cells, making it an ideal tool for studying T cell activation and function. The Ovalbumin antibody is reactive and can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used as a diagnostic reagent for detecting ovalbumin or related proteins in human serum samples. Additionally, this antibody has neutralizing properties and can inhibit the activity of TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. With its high specificity and affinity, the Ovalbumin antibody is an essential tool for researchers working in the field of immunology and molecular biology.
GAP43 antibody
The GAP43 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used to study the role of interferon in cellular processes. The antibody is produced by immunizing animals with GAP43, a protein found in the nervous system. It has high specificity and affinity for its target, making it an ideal tool for detecting and quantifying GAP43 levels in various biological samples.
PLEKHF1 antibody
The PLEKHF1 antibody is a highly specialized monoclonal antibody that serves as a serum marker for various medical conditions. This antibody specifically targets and binds to the PLEKHF1 antigen, which plays a crucial role in the regulation of interleukin production and immune response. By inhibiting the activity of PLEKHF1, this antibody can be used as a potential medicament in the treatment of autoimmune diseases, inflammatory disorders, and certain types of cancers.
HPRT antibody
The HPRT antibody is a highly specialized monoclonal antibody that is used in various assays and experiments in the field of Life Sciences. It specifically targets the hypoxanthine-guanine phosphoribosyltransferase (HPRT) enzyme, which plays a crucial role in the metabolism of purine nucleotides.
GEM antibody
GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
AQP4 antibody
The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.
ASL antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.
METTL1 antibody
METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
ID4 antibody
The ID4 antibody is a highly specialized product used in the field of Life Sciences. It is commonly employed in chromatographic techniques and immobilization processes. This antibody specifically targets angptl3, a growth factor protein involved in various biological processes such as collagen production and cell growth. The ID4 antibody is known for its neutralizing properties, effectively inhibiting the activity of angptl3 dimers.
RTP4 antibody
RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA
Desmocollin 1 antibody
Desmocollin 1 antibody was raised in mouse using synthetic peptide corresponding to sequence present within the intracellular part of human desmocollin 1 as the immunogen.Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.
AQP2 antibody
The AQP2 antibody is an immobilized monoclonal antibody that specifically targets the AQP2 antigen. It is commonly used in Life Sciences research to study amyloid plaque formation and to investigate the role of AQP2 in various physiological processes. The AQP2 antibody can also be used in combination with other antibodies, such as anti-CD20 antibodies, for immunotherapy purposes. This antibody is highly specific and has been extensively validated for its efficacy and reliability. Researchers can use the AQP2 antibody in experiments involving techniques like electrode-based assays or as inhibitors to study the effects of blocking AQP2 function. Its versatility makes it a valuable tool for scientists working in various fields, including molecular biology, biochemistry, and immunology.
GSTP1 antibody
GSTP1 antibody was raised using the N terminal of GSTP1 corresponding to a region with amino acids TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ
LHR antibody
The LHR antibody is a high-quality polyclonal antibody that specifically targets the luteinizing hormone receptor (LHR). It is widely used in various research fields, particularly in the life sciences. This antibody is highly specific and exhibits strong binding affinity to LHR, making it an excellent tool for studying the role of LHR in different biological processes.
FABP3 antibody
FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL
ERCC6 antibody
ERCC6 antibody was raised in mouse using recombinant Human Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6 (Ercc6)
RAB3A antibody
The RAB3A antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including cytotoxicity, mitogen-activated protein signaling, and protein synthesis. This antibody specifically targets RAB3A, a small GTPase involved in vesicle trafficking and neurotransmitter release.
RXRB antibody
The RXRB antibody is a monoclonal antibody that targets the retinoid X receptor beta (RXRB). This receptor is involved in various cellular processes, including growth and development. The RXRB antibody has been shown to have cytotoxic effects on cancer cells, particularly in HL-60 cells. It binds to specific binding proteins and inhibits the activity of tumor necrosis factor-alpha (TNF-α) and vascular endothelial growth factor (VEGF), which are important factors in cancer progression. Additionally, the RXRB antibody has been found to have anti-glycation properties and may play a role in regulating hormone peptides. In the field of Life Sciences, this antibody is widely used for research purposes, including studying signal transduction pathways and developing targeted therapies. It is also being investigated as a potential family kinase inhibitor and an anti-CD33 antibody for the treatment of certain types of leukemia.
TRNT1 antibody
TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
IL6 antibody
The IL6 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a key growth factor involved in various physiological processes. This antibody has been extensively studied and proven to be effective in inhibiting the activity of IL-6.COL4A3 antibody
COL4A3 antibody is a high-quality antibody used in Life Sciences research. It is specifically designed to target and bind to the COL4A3 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its specificity and sensitivity.
Kallikrein antibody
Kallikrein antibody is a powerful tool used in life sciences research. It targets kallikrein, an enzyme involved in various physiological processes such as blood pressure regulation, inflammation, and tissue remodeling. This antibody can inhibit the activity of kallikrein by binding to its active site, thus preventing its interaction with substrates.
TBLR1 antibody
The TBLR1 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody specifically targets caspase-9, an enzyme involved in programmed cell death.
Triosephosphate isomerase antibody
Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.
IGFBP1 antibody
The IGFBP1 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes insulin-like growth factor binding protein 1 (IGFBP1). IGFBP1 is a key regulator of neurotrophic factors, such as TGF-β1, and plays a crucial role in various biological processes. By blocking the activity of IGFBP1, this antibody can modulate important cellular functions including natriuretic signaling, collagen synthesis, chemokine production, protein kinase activation, and nuclear events. Whether you are conducting research or developing therapeutics, the IGFBP1 antibody is an invaluable asset that can help unravel the complex mechanisms underlying various diseases and pave the way for novel treatments.
ANTP antibody
ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
GST antibody
The GST antibody is a highly reactive and cytotoxic monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the glutathione S-transferase (GST) protein, which plays a crucial role in detoxification processes within cells. The GST antibody can be used to detect and quantify GST levels in various samples, including human serum.IL23 antibody
IL23 antibody is an immunosuppressant that belongs to the class of monoclonal antibodies. It specifically targets IL-23, a cytokine involved in immune responses and inflammation. By binding to IL-23, this antibody prevents its interaction with its receptor, thereby inhibiting the downstream signaling pathways that lead to inflammation. IL23 antibody has been shown to effectively reduce the production of pro-inflammatory cytokines and inhibit the activation of immune cells. This antibody is commonly used in research and clinical settings to study the role of IL-23 in various diseases, including autoimmune disorders and cancer. Its high specificity and potency make it a valuable tool for investigating the therapeutic potential of targeting IL-23 in these conditions.
UBE2L3 antibody
UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
AKR1B10 antibody
The AKR1B10 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets AKR1B10, an enzyme involved in various cellular processes. This antibody offers high photostability and has been extensively tested for its specificity and sensitivity.
Cul4B antibody
The Cul4B antibody is a highly specialized and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the Cul4B protein, which plays a crucial role in various cellular processes. The Cul4B protein is involved in the regulation of epidermal growth factor signaling, parathyroid hormone-related protein expression, and chemokine-like activity.
NAT9 antibody
NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ
ACADM antibody
ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
TSGA13 antibody
TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
hCG beta antibody
The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.
CAV2 antibody
The CAV2 antibody is a polyclonal antibody commonly used in the field of life sciences. Polyclonal antibodies are produced by injecting an antigen into an animal, which then produces a wide range of antibodies that can recognize different epitopes on the target protein. This particular polyclonal antibody has been shown to be effective in inhibiting the activity of specific proteins, leading to an antinociceptive effect. Antinociceptives are substances that reduce sensitivity to painful stimuli and can act as analgesic agents. The CAV2 antibody has potential therapeutic applications in the development of analgesic treatments and as part of vaccine strategies against specific strains of pathogens. Its versatility and ability to target multiple epitopes make it a valuable tool for researchers in various fields of study.
IFI35 antibody
IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL
