Anticorps primaires

CD51 antibody (PE) was raised in mouse using human CD51 as the immunogen.

SLC35F5 antibody was raised using the C terminal of SLC35F5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI

Affinity purified Rabbit polyclonal NDUFV2 antibody

ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

EVL antibody was raised in Rabbit using Human EVL as the immunogen

CD97 antibody was raised in Rabbit using Human CD97 as the immunogen

DAK antibody was raised in Rabbit using Human DAK as the immunogen

Mouse monoclonal Glucagon antibody (Biotin)

CSNK1D antibody was raised in Rabbit using Human CSNK1D as the immunogen

Rabbit polyclonal KCY antibody

Affinity purified Rabbit polyclonal CPOX antibody

The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.

Rabbit polyclonal ECSA antibody

The S100B antibody is a highly specialized product in the field of Life Sciences. It is an antibody derived from human immunoglobulin that specifically targets the growth hormone receptor. This monoclonal antibody has been developed as a chimeric protein, which enhances its efficacy and specificity.

CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.

Rabbit polyclonal TMEM50B antibody

Rabbit polyclonal RPL36A antibody

The PCDGF antibody is a highly specialized monoclonal antibody that targets the growth factor associated with non-alcoholic steatohepatitis (NASH). This antibody has been extensively tested and proven to effectively neutralize the activity of this growth factor, preventing its detrimental effects on liver health. By binding to the growth factor, the PCDGF antibody inhibits its ability to induce inflammation and fibrosis in the liver.

LGALS3 antibody was raised using the N terminal of LGALS3 corresponding to a region with amino acids GASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPG

Rabbit polyclonal RAB3B antibody

The AChE antibody is a highly specific antibody used in life sciences research. It can be either a polyclonal antibody or a monoclonal antibody, depending on the specific application. This antibody is designed to target and bind to acetylcholinesterase (AChE), an enzyme responsible for the breakdown of acetylcholine.

The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.

Mouse monoclonal KCNAB1 antibody

Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

Affinity purified Rabbit polyclonal MPP3 antibody

APLF antibody was raised in Rabbit using Human APLF as the immunogen

Affinity purified Rabbit polyclonal Docking protein 3 antibody

Rabbit polyclonal PPPDE1 antibody

NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP

Rabbit polyclonal AQP2 antibody (Ser261)

GTPBP5 antibody was raised in Rabbit using Human GTPBP5 as the immunogen

Mouse monoclonal V beta 13.1 TCR antibody (FITC)

RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

Affinity purified Rabbit polyclonal HSD17B4 antibody

NIT2 antibody was raised in Rabbit using Human NIT2 as the immunogen

Mouse monoclonal CD24 antibody (biotin)

Rabbit polyclonal COX5B antibody (biotin)

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). This receptor plays a crucial role in various biological processes, including inflammation, cell proliferation, and cell survival. The RAGE antibody has cytotoxic properties and can neutralize the effects of RAGE activation.

The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.

The HSF1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes arginase, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in blocking the activity of arginase, allowing researchers to investigate its role in different biological systems.

The ITGB3 antibody is a highly specialized product that is used in the field of Life Sciences. This antibody specifically targets and binds to the integrin beta-3 subunit (ITGB3), which plays a critical role in various cellular processes. The ITGB3 antibody has been extensively studied for its potential therapeutic applications.

IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE

MYO7B antibody was raised in Rabbit using Human MYO7B as the immunogen

RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

Rabbit polyclonal GABBR1 antibody (Ser923) (R1-Subunit)

The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.

Mouse monoclonal DYNC1LI1 antibody

Rabbit polyclonal MOR antibody (Ser375)

Rabbit polyclonal SOD1 antibody (biotin)

The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.

Affinity purified Rabbit polyclonal NAT2 antibody

Affinity purified Rabbit polyclonal Adenosine A2AR antibody

Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.

Affinity purified Rabbit polyclonal RAB3C antibody

Purified Polyclonal MLCK1 antibody

GALK1 antibody was raised in Rabbit using Human GALK1 as the immunogen

HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

Affinity purified Rabbit polyclonal Cullin 3 antibody

The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.

The DUSP3 antibody is a highly effective monoclonal antibody that acts as an inhibitor for the mineralocorticoid receptor. It has the ability to interfere with the activity of interferons and growth factors, making it a valuable tool in various research applications. This antibody specifically targets nuclear receptors and has been extensively tested for its efficacy and specificity. In addition, it can be used in combination with other biomolecules such as polyclonal antibodies, ornithine, transferrin, and haloperidol to form protein complexes that have a wide range of applications. The DUSP3 antibody has also shown promising results in inhibiting interleukin-6 activity, making it an important tool for studying immune responses and inflammation.

RPL39 antibody was raised in rabbit using the N terminal of RPL39 as the immunogen

The Angiotensin II antibody is a powerful tool in the field of immunology. It is an antibody specifically designed to target and bind to angiotensin II, a hormone involved in regulating blood pressure and fluid balance in the body. This antibody can be used for various applications, including research studies, diagnostic tests, and therapeutic interventions.

FBXL14 antibody was raised in Rabbit using Human FBXL14 as the immunogen

METTL5 antibody was raised in Rabbit using Human METTL5 as the immunogen

Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the

Mouse monoclonal STAT4 antibody

Rabbit polyclonal FHIT antibody (biotin)

Affinity purified Rabbit polyclonal PMM2 antibody

EML2 antibody was raised in Rabbit using Human EML2 as the immunogen

The VTA1 antibody is a serum marker used in the field of Life Sciences. It is a highly effective medicament that targets specific cation channels in the body. This antibody has been extensively studied and has shown promising results in various research areas. It has been found to inhibit the activity of methyl transferase enzymes, which play a crucial role in gene regulation and protein synthesis. Additionally, the VTA1 antibody has been shown to modulate interleukin production, which is important for immune response and inflammation regulation. Available as both polyclonal and monoclonal antibodies, this product offers researchers a versatile tool for their experiments. Its unique mechanism of action makes it an ideal candidate for studying various cellular processes and pathways. Whether you are studying carnitine metabolism or investigating the function of octanoyltransferase enzymes, the VTA1 antibody can provide valuable insights. With its high-flux binding capabilities and potent inhibitory effects, this antibody is a must-have for any researcher working in

Affinity purified Rabbit polyclonal ALS2CR3 antibody

Rabbit polyclonal HNRPH1 antibody (biotin)

TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Rabbit polyclonal CaMK2 alpha/beta/theta antibody

Rabbit polyclonal UQCRQ antibody

The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.

The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.

The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.

The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

Purified Polyclonal NAA15 antibody

EGFR antibody (AF488) was raised in mouse using human A431 membrane proteins as the immunogen.

SLC12A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC

Rabbit polyclonal Beta Enolase antibody (HRP)

Purified Polyclonal PPP4R1L antibody

WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA

RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.

CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.

Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal EMR4 antibody

The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.

Rabbit polyclonal IP3R1 antibody (Ser1764)

Rat monoclonal CD45R antibody (biotin)

Goat anti Pig IgM secondary antibody (Alk Phos)

CASP3 antibody was raised in Rabbit using Human CASP3 as the immunogen

Rat monoclonal NGAL antibody (Biotin)

Armenian Hamster monoclonal CD61 antibody (FITC)

Affinity purified Rabbit polyclonal XPNPEP2 antibody

Purified Polyclonal NEIL3 antibody

The UBE2L3 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the UBE2L3 protein, which plays a crucial role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

TBCD antibody was raised in rabbit using the N terminal of TBCD as the immunogen

The NSE antibody is a powerful tool in the field of Life Sciences. It is a growth factor that neutralizes cytotoxic effects and chemokines in various biological processes. This antibody specifically targets TGF-beta, a protein known for its role in cell growth and differentiation. The NSE antibody can be used in research and diagnostic applications to detect and measure the levels of TGF-beta in samples. Additionally, it has been used as a therapeutic agent, particularly in the treatment of collagen-related diseases and as an inhibitor of anti-ACTH antibodies. Its versatility makes it an essential component for scientists studying various cellular processes and diseases, including Mycoplasma genitalium infections. Trust the NSE antibody to provide accurate and reliable results for your research needs.

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

GRID1 antibody was raised in Rabbit using Human GRID1 as the immunogen

The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development

Affinity purified Rabbit polyclonal PECR antibody

The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.

Rabbit polyclonal USP20 antibody

Affinity purified Rabbit polyclonal PEX19 antibody

Affinity purified Rabbit polyclonal ADAMTSL2 antibody

Mouse monoclonal MVK antibody

CD56 antibody (FITC) was raised in mouse using human CD56 as the immunogen.

Armenian Hamster monoclonal CD49e antibody (FITC)

The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.

CD62L antibody (Allophycocyanin-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.

HNRPDL antibody was raised in Rabbit using Human HNRPDL as the immunogen

The NKG2D antibody is a highly specialized antibody that targets the vasoactive intestinal peptide. It belongs to the class of polyclonal antibodies and exhibits cytotoxic effects. This monoclonal antibody is designed to specifically bind to autoantibodies, preventing their harmful effects on the body. With its unique structure and composition of lysine and acid residues, this antibody has the ability to induce lysis of targeted cells. Its multidrug properties make it highly effective in combating various diseases and conditions. The NKG2D antibody is activated upon binding to necrosis factor-related apoptosis-inducing markers, leading to targeted cell death. Its nuclear-specific targeting makes it a valuable tool in research and diagnostics. With its multispecific nature, this monoclonal antibody offers a versatile solution for a wide range of applications.

The CDK2 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to cyclin-dependent kinase 2 (CDK2), a protein that plays a crucial role in cell cycle regulation. By binding to CDK2, this antibody can inhibit its activity and prevent cell division.

Rabbit polyclonal NDUFA1 antibody

CD49d antibody (biotin) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.

The MPP1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and specifically targets interleukin, an important cytokine involved in various immune responses. This antibody can be used in assays and experiments to detect and measure the levels of interleukin in samples. It is also useful for studying autoantibodies, which are antibodies that target the body's own tissues.

Rabbit polyclonal CYB5 antibody (HRP)

Affinity purified Rabbit polyclonal Proteasome 20S alpha 7 antibody

RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Affinity purified Rabbit polyclonal C5L2 antibody

Affinity purified Rabbit polyclonal DOCK1 antibody

The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.

Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

Rabbit polyclonal WRKY63.1 antibody

GTF2F1 antibody was raised in Rabbit using Human GTF2F1 as the immunogen

Affinity purified Rabbit polyclonal IL22 Receptor alpha 2 antibody

IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen

NUP153 antibody was raised in mouse using nuclear matrix protein fraction prepared from rat liver nuclei as the immunogen.

The PINX1 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and neutralizes the PINX1 protein. This protein is found in various tissues, including liver microsomes, and plays a role in regulating important cellular processes such as dopamine signaling, oncostatin production, and β-catenin localization within the nucleus.

Affinity purified Rabbit polyclonal DAP5 antibody

CD3e antibody (Spectral Red) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.

Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE

Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.

Rabbit polyclonal TUBB3 antibody (FITC)

The NOS2 antibody is a highly specialized autoantibody that targets the glycan structure of the EBNA1 protein. This polyclonal antibody is derived from plasmids and has been extensively studied for its genotoxic effects. It specifically recognizes and binds to the NOS2 protein, an important enzyme involved in nitric oxide production. The NOS2 antibody can be used in various life science applications, including research on interferon and interleukin-6 signaling pathways. Additionally, it is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their specific needs. Trust in the reliability and specificity of this antibody to enhance your experiments in the field of life sciences.

PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen

Affinity purified Rabbit polyclonal ATP6V0A2 antibody

PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen

CDC2L6 antibody was raised in Rabbit using Human CDC2L6 as the immunogen

HOXC9 antibody was raised in mouse using recombinant Homeo Box C9

The GHRHR antibody is a powerful inhibitor that targets the TRPV4 channel, making it an effective medicament for various applications. This antibody specifically inhibits the activity of serine proteases, reducing the risk of excitotoxicity and protecting cells from damage. It has been widely used in the field of life sciences as a diagnostic agent to detect specific proteins such as myoglobin, fibrinogen, and MIP-1β. Additionally, this antibody has shown promising results in pluripotent stem cell research by regulating lactate production and promoting cell differentiation. With its multifaceted properties and diverse applications, the GHRHR antibody is a valuable tool for researchers and medical professionals alike.

KIF2B antibody was raised in Rabbit using Human KIF2B as the immunogen

Purified Rabbit polyclonal MBL2 antibody

Rabbit polyclonal PRKCSH antibody

Affinity purified Rabbit polyclonal IPMK antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

MRPL21 antibody was raised in Rabbit using Human MRPL21 as the immunogen

The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.

The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to dopamine beta hydroxylase, an enzyme involved in the synthesis of norepinephrine. This antibody is commonly used in research and diagnostic assays to study the role of dopamine beta hydroxylase in various biological processes.

CAPN6 antibody was raised in Rabbit using Human CAPN6 as the immunogen

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

Purified Polyclonal Inhibin beta A antibody

Mouse monoclonal FSHB antibody

Rat monoclonal CD8 antibody (PE); IgG2b kappa

RNF2 antibody was raised in Rabbit using Human RNF2 as the immunogen

The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.

CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface protein involved in various immune responses. This antibody has been shown to neutralize the activity of CD11b and inhibit its function in immune cells. CD11b antibody has been used in research studies to investigate the role of CD11b in different biological processes, including hepcidin regulation, interleukin-6 signaling, and syncytia formation. It has also been shown to modulate intracellular signaling pathways such as the p38 MAPK pathway and protein kinases. This antibody is widely used in life sciences research for its ability to selectively bind and block CD11b activity, making it a valuable tool for studying immune responses and developing potential therapeutic interventions.

CD71 antibody was raised in rat using CD71/transferrin receptor as the immunogen.

Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.

Affinity purified Rabbit polyclonal C1orf57 antibody

Rabbit polyclonal OLFM2 antibody