Anticorps primaires

ARF1 antibody was raised in Rabbit using Human ARF1 as the immunogen

PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen

BFSP1 antibody was raised in Rabbit using Human BFSP1 as the immunogen

Rabbit polyclonal SHC antibody (Tyr427)

Affinity purified Rabbit polyclonal CLN2 antibody

Affinity purified Rabbit polyclonal TCP1 epsilon antibody

LOH12CR1 antibody was raised in Rabbit using Human LOH12CR1 as the immunogen

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

NEU4 antibody was raised in Rabbit using Human NEU4 as the immunogen

CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.

Rabbit polyclonal PASP antibody

The p21 antibody is a chemokine that is widely used in immunoassays. It belongs to the class of polyclonal antibodies and is commonly used as a medicament in various applications. This antibody has been shown to have reactive and neutralizing properties, making it highly effective in targeting specific antigens. It is often used in research involving mesenchymal stem cells and cardiomyocytes, where it plays a crucial role in studying their functions and interactions. The p21 antibody is also used in the detection and measurement of various substances, such as steroids and recombinant antigens, through antigen-antibody reactions. In the field of Life Sciences, this antibody is an essential tool for researchers conducting experiments involving polymerase chain reactions, acetylcholine signaling, and the study of autoantibodies. With its versatility and reliability, the p21 antibody is an invaluable asset for scientists seeking to advance their understanding of cellular processes and develop innovative medical solutions.

ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen

Rat monoclonal Toll-like receptor 9 antibody (PE)

Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen

MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.

CLSTN1 antibody was raised in Rabbit using Human CLSTN1 as the immunogen

PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal TRAM2 antibody

HTR3A antibody was raised in Rabbit using Human HTR3A as the immunogen

HOXC10 antibody was raised in Rabbit using Human HOXC10 as the immunogen

Affinity purified Rabbit polyclonal Fibrinogen gamma antibody

Affinity purified Rabbit polyclonal FLJ35630 antibody

RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI

Rabbit polyclonal RAD23B antibody

The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.

Purified Polyclonal FOXC1/2 antibody

The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.

Mouse monoclonal SNX8 antibody

RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen

Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.

The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.

Affinity purified Rabbit polyclonal ZPBP antibody

The CEA antibody is a powerful growth factor that plays a crucial role in various biological processes. It interacts with transferrin and TNF-α to regulate hepatocyte growth and function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One notable application is its use as a targeted therapy. The CEA antibody, when conjugated with other therapeutic agents such as trastuzumab (anti-HER2 antibody), can specifically target cancer cells that overexpress certain markers, leading to their selective destruction. This targeted approach minimizes damage to healthy cells and reduces side effects. Additionally, the CEA antibody has been found to be an effective tool in research and diagnostics. It can be used as an activated electrode for the detection of specific biomarkers, such as annexin or chemokines, allowing for precise measurements and analysis. Moreover, monoclonal antibodies against CEA have been developed for the detection and quantification of CEA levels

HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH

The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.

Rabbit polyclonal SPATA13 antibody

Rabbit polyclonal RPS10 antibody

Armenian Hamster monoclonal CD29 antibody (PE)

Rabbit polyclonal TRMT5 antibody

MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

Rabbit polyclonal TNF alpha antibody (biotin)

Rabbit polyclonal SYT12 antibody

Rabbit polyclonal SGTA antibody

CD22 antibody was raised in rat using CD22 as the immunogen.

Goat anti-human lambda chain (biotin) was raised in goat using human l lambda chain as the immunogen.

Affinity purified Rabbit polyclonal MAPK 8/9 antibody

ICAM4 antibody was raised in Rabbit using Human ICAM4 as the immunogen

MCP4 antibody was raised in mouse using highly pure recombinant human MCP-4 as the immunogen.

Rabbit polyclonal MAZ antibody

DPP7 antibody was raised in Rabbit using Human DPP7 as the immunogen

FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.

ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Rabbit polyclonal PRKAR2B antibody

Rabbit polyclonal CLCN6 antibody

Affinity purified Rabbit polyclonal COUP TF1 antibody

Rabbit polyclonal IP6K3 antibody

Rabbit polyclonal GPR92 antibody

ATL1 antibody was raised in Rabbit using Human ATL1 as the immunogen

Mouse monoclonal EFNA2 antibody

Rabbit polyclonal TAGLN3 antibody

CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.

HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.

The beta Amyloid antibody is a polyclonal antibody used in life sciences research. It specifically targets the beta amyloid protein, which plays a crucial role in the development of Alzheimer's disease. This antibody can be used for various applications such as immunohistochemistry and nuclear staining. By binding to the beta amyloid protein, this antibody helps researchers study its distribution and localization within cells and tissues. Additionally, it can be used as a potential medicament for targeting beta amyloid in therapeutic interventions. The beta Amyloid antibody is highly specific and exhibits strong affinity towards its target, making it an essential tool for studying the pathogenesis of Alzheimer's disease and developing novel treatment strategies.

The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.

HEXIM1 antibody was raised in Rabbit using Human HEXIM1 as the immunogen

CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen

The PERK antibody is a polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the activated form of PERK (protein kinase RNA-like endoplasmic reticulum kinase). This monoclonal antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

The API5 antibody is an adeno-associated polypeptide that has the ability to bind to antigenic proteins and inhibit their activity. It is commonly used as a research tool in the development of inhibitors for various diseases. The API5 antibody has been shown to have a high affinity for heparin, which makes it an effective compound for inhibiting heparin cofactor activity. Additionally, this antibody can be used in the production of polyclonal antibodies, which are essential tools in biomedical research. It is also known to have autoantibodies properties and can be utilized in the development of medicines targeting serotonin-related disorders.

The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.

The NUFIP1 antibody is a powerful medicament that acts as an interferon and carboxyl esterase inhibitor. It has antiviral properties and is commonly used in the development of vaccines. This antibody works by inhibiting the formation of antibodies, making it an effective tool for studying immune responses. Additionally, it can be used as a fluorescence probe in various life sciences applications. With its ability to bind to specific targets, the NUFIP1 antibody is a valuable tool for researchers and scientists working in the field of medicine and immunology.

Goat anti Human IgE antibody

RNF39 antibody was raised using the N terminal of RNF39 corresponding to a region with amino acids EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD

Rabbit polyclonal SH2D2A antibody

The IL4 antibody is a multidrug that targets specific proteins in the body. It has been shown to have a significant impact on human hepatocytes, inhibiting the production of alpha-fetoprotein and anti-glial fibrillary acidic protein. This antibody is part of a class of chimeric proteins known as polyclonal antibodies, which are widely used in Life Sciences research. The IL4 antibody also acts as an inhibitor, blocking the activity of certain enzymes and molecules involved in various biological processes. It is commonly conjugated with biotinylation and can be easily detected using streptavidin-based detection systems. With its high specificity and affinity, the IL4 antibody offers great potential for therapeutic applications and further scientific investigations.

PRKAA2 antibody was raised using the middle region of PRKAA2 corresponding to a region with amino acids AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

G6pc antibody was raised in rabbit using the N terminal of G6pc as the immunogen

ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.

The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.

Rabbit polyclonal SLC9A8 antibody

Affinity purified Rabbit polyclonal Glycerol kinase 2 antibody

Rabbit polyclonal Alkylphenols antibody

Rabbit polyclonal ARF5 antibody (HRP)

Rat monoclonal TER119 antibody (FITC)

USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE

The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.

The IFN alpha antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is known for its antiviral properties. This antibody specifically targets CD20 antibodies, making it an effective tool for research and therapeutic applications.

CISD2 antibody was raised in Rabbit using Human CISD2 as the immunogen

The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.

ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR

MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen

WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

Purified Polyclonal COL6A2 antibody

Rabbit polyclonal YWHAB antibody

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.

Rabbit polyclonal SLC35A1 antibody

JAKMIP2 antibody was raised in Rabbit using Human JAKMIP2 as the immunogen

PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR

Rabbit polyclonal RPL30 antibody

The XAF1 antibody is a high-quality monoclonal antibody that specifically binds to XAF1 protein, an important regulator of apoptosis. This antibody can be used for the treatment and/or prophylaxis of various diseases, including cancer. The XAF1 antibody has been extensively tested in both in vitro and in vivo studies, demonstrating its efficacy in inducing apoptosis in cancer cells.

Rabbit anti human IgG (Fc) (Agarose Conjugated) was raised in rabbit using human IgG F(c) fragment as the immunogen.

Rabbit polyclonal IKBE antibody (Ser22)

KCND1 antibody was raised in Rabbit using Human KCND1 as the immunogen

Affinity purified Rabbit polyclonal Cyclin T2 antibody

ABCA2 antibody was raised in Rabbit using Human ABCA2 as the immunogen

The BAG2 antibody is a highly specialized monoclonal antibody that targets specific antigens in the field of Life Sciences. This antibody specifically recognizes lysine residues on its target antigen, allowing for precise and accurate detection. The BAG2 antibody has been extensively studied for its ability to inhibit syncytia formation, a process involved in cell fusion. Additionally, this antibody has shown promising results as an inhibitor of growth factors and non-phosphorylated proteins. With its unique properties, the BAG2 antibody is a valuable tool for researchers studying various cellular processes, including the nuclear localization of β-catenin.

The STIP1 antibody is a monoclonal antibody that has a stimulatory effect on various biological processes in the Life Sciences field. It specifically targets lectins and autoantibodies, and has been extensively studied for its potential therapeutic applications. This antibody is designed to bind to specific epitopes on the target protein, leading to modulation of various cellular pathways.

The IL2 antibody is a monoclonal antibody that specifically targets interleukin-2 (IL-2), a glycoprotein involved in the regulation of immune responses. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and autoimmune disorders.

HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.

Rabbit polyclonal RAB31 antibody

MIER1 antibody was raised in Rabbit using Human MIER1 as the immunogen

Affinity purified Rabbit polyclonal HMGB4 antibody

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

ADAD2 antibody was raised in Rabbit using Human ADAD2 as the immunogen

ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL

TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV

Rabbit polyclonal FBP2 antibody

MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM

This antibody reacts with heavy chains on human IgG (gamma chain).

Mouse monoclonal Complement D antibody (Biotin)

Rabbit polyclonal STX12 antibody

Mouse monoclonal C17orf28 antibody

Rabbit polyclonal TXNL6 antibody

CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.

CNKSR1 antibody was raised in Rabbit using Human CNKSR1 as the immunogen

The Synaptophysin antibody is a highly effective monoclonal antibody used in pharmaceutical preparations. This antibody specifically targets synaptophysin, a protein found in cholinergic neurons, making it an ideal tool for studying the function and distribution of these neurons. The Synaptophysin antibody can be used in various bioassays, such as immunohistochemistry and Western blotting, to detect and quantify synaptophysin expression. Additionally, this antibody has been shown to inhibit the formation of dimers of synaptophysin, which are involved in protein-protein interactions and important for synaptic vesicle exocytosis. With its high specificity and sensitivity, the Synaptophysin antibody is an invaluable tool for researchers in the Life Sciences field.

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes.

Rabbit polyclonal RPS13 antibody

Rabbit polyclonal CD336 antibody

Rabbit polyclonal TRPS1 antibody

Armenian Hamster monoclonal CD61 antibody (biotin)

The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.

The Ibuprofen antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to Ibuprofen, a nonsteroidal anti-inflammatory drug commonly used for pain relief and reducing inflammation. This antibody can be used in various assays, including nuclear and GAPDH assays, to detect the presence and levels of Ibuprofen in samples.

Affinity purified Rabbit polyclonal Laminin gamma 2 antibody

The TOM20 antibody is a monoclonal antibody that has a wide range of applications in the field of Life Sciences. It specifically targets TOM20, a protein involved in mitochondrial import and sorting. This antibody can be used for various research purposes, including the detection and quantification of TOM20 in different biological samples.

SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS

STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

GYG2 antibody was raised in Rabbit using Human GYG2 as the immunogen

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

CHRNB1 antibody was raised in Rabbit using Human CHRNB1 as the immunogen

CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.

GHITM antibody was raised in Rabbit using Human GHITM as the immunogen

Mouse monoclonal CD10 antibody (FITC)

Rabbit polyclonal MAD4 antibody

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Purified Rabbit polyclonal MPHOSPH9 antibody

The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.

IRF3 antibody was raised in Rabbit using Human IRF3 as the immunogen

ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen

Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.

C5AR1 antibody was raised in Rabbit using Human C5AR1 as the immunogen

Rabbit polyclonal FKRP antibody

The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.

Rabbit polyclonal SNAPIN antibody

The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.

MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE

Affinity purified Rabbit polyclonal VAM1 antibody

The CD80 antibody is a highly effective and versatile tool in the field of Life Sciences. This monoclonal antibody has a colloidal structure that allows it to efficiently bind to collagen and other target molecules. It is commonly used in research and diagnostic applications, particularly in the study of TGF-beta signaling pathways.

Rabbit polyclonal GABRD antibody (N-Terminus)

The TH antibody is a neuroprotective antibody that targets tyrosine hydroxylase (TH), an enzyme involved in the synthesis of dopamine. It specifically recognizes and binds to various isoforms of 14-3-3 proteins when they are activated. This antibody has been extensively used in Life Sciences research for its ability to detect and quantify TH levels in different tissues and cell types.

Rabbit polyclonal Transaldolase antibody (FITC)

Affinity purified Rabbit polyclonal MAPK4 antibody

The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.

Rabbit Polyclonal BCL2L12 antibody

Rabbit polyclonal SLC17A1 antibody

Rabbit polyclonal CSTF1 antibody

BRUNOL6 antibody was raised in Rabbit using Human BRUNOL6 as the immunogen