Anticorps primaires

Mouse monoclonal Cytokeratin AE1 antibody

Rabbit polyclonal UTP20 antibody

This product is a protein A purified mouse monoclonal antibody with clones of the immunoglobulin subclasses: IgG1 and IgG2a available. These clones recognise human D-Dimer and high molecular weight fibrin degradation products and no cross-reactions is observed with fibrinogen and D-monomer. A potential application of this product is for coating to latex particles for latex enhanced immunoturbidimetric applications. It can further be used in ELISA and immunofluorescent assays.
Human D-dimer, a soluble fibrin degradation product recognised by this antibody product, can be used as a marker for clinical conditions where the process of coagulation and fibrinolysis have been activated. For example it can be used in the diagnosis of venous thromboembolism and intravascular coagulation. The formation of human D-dimer occurs when fibrinogen is converted to fibrin monomers when the enzyme thrombin cleaves fibrinopeptides at the N-terminal domain of fibrinogen. These monomers aggregate when interacting with another enzyme: activated factor XIII (factor XIIIa) forming a cross-linked fibrin polymer, also known as a fibrin clot. A final enzyme, plasmin, degrades this fibrin clot, resulting in D-dimer. It is important to note that when applying this product clinically, levels of D-dimer can be influenced by human factors such as age, pregnancy and cancer.

Affinity purified Rabbit polyclonal Glycine Receptor alpha 2 antibody

Affinity purified Rabbit polyclonal HSP90B antibody

Affinity purified Rabbit polyclonal EPHX1 antibody

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a β-ribbon connector region. While E2 is essential for mediating viral attachment, E1’s β-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host’s membrane. This primarily occurs through the insertion of the DII domain’s fusion loop into the host’s cell membrane.
Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2’s A and B domains and E1’s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus.

The SCF antibody is a highly specialized monoclonal antibody that plays a crucial role in inhibiting the endocytic uptake of growth factors such as collagen and fatty acids. This antibody acts as a neutralizing agent and specifically targets the low-density lipoprotein receptor-related protein (LRP), preventing its activation by interfering with its binding to growth factors. By blocking this interaction, the SCF antibody effectively hinders the downstream signaling pathways involved in cell proliferation and differentiation.

The Glucagon antibody is a powerful tool in the field of medical research and diagnostics. This antibody specifically targets glucagon, an important hormone involved in regulating blood sugar levels. It has been extensively studied and characterized for its ability to bind to glucagon with high affinity and specificity.

Affinity purified Rabbit polyclonal Apoptosis enhancing nuclease antibody

GANP antibody is a monoclonal antibody that targets the GANP protein. This protein plays a crucial role in various cellular processes, including histidine metabolism, epidermal growth factor signaling, and β-catenin regulation. By specifically binding to GANP, this antibody inhibits its function and disrupts the normal cellular processes associated with it.

WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

The SQSTM1 antibody is a highly specialized monoclonal antibody that is used for immobilization and detection of SQSTM1 protein. It specifically targets and binds to the SQSTM1 protein, allowing for its easy detection and analysis in various biological samples. This antibody is widely used in research laboratories and diagnostic settings to study the role of SQSTM1 in different cellular processes.

CDK3 antibody was raised in rabbit using the C terminal of CDK3 as the immunogen

ZNF335 antibody was raised in rabbit using the middle region of ZNF335 as the immunogen

Rabbit polyclonal TROVE2 antibody

The TYK2 antibody is a powerful tool used in the field of Life Sciences. It is a multidrug that targets the nuclear chemokine receptors and acts on actin filaments. This antibody has been extensively studied and has shown efficacy in various research areas.

CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.

The HSF2 antibody is a biomolecule widely used in Life Sciences research. It plays a crucial role in various applications such as electrophoresis, neutralizing specific proteins or molecules, and measuring microvessel density. This antibody has shown promising results in inhibiting the activity of erythropoietin, a growth factor involved in red blood cell production. Additionally, it has been used as an immunosuppressant and is commonly employed in immunoassays to detect specific targets. The HSF2 antibody exhibits cytotoxic properties and can be utilized as a tool for targeted therapy. It is available as a monoclonal antibody and can be combined with other colloidal inhibitors for enhanced efficacy. Researchers also explore the potential of this antibody as a natriuretic agent due to its ability to regulate fluid balance within the body.

The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.

CD72.1 antibody (biotin) was raised in mouse using DBA/2 murine spleen cells as the immunogen.

Rabbit polyclonal GPR103 antibody

The SKP2 antibody is a monoclonal antibody that targets the growth factor SKP2. It acts as a kinase inhibitor, inhibiting the activity of SKP2 and preventing its role in cell proliferation. This antibody has been shown to have inhibitory properties against various growth factors, including epidermal growth factor and interferon. Additionally, it has been found to modulate the levels of creatine kinase and β-catenin, which are important proteins involved in cell signaling pathways. The SKP2 antibody can be used for research purposes, such as studying the cytotoxic effects of SKP2 inhibition or investigating its role in collagen synthesis.

APOH antibody was raised in Rabbit using Human APOH as the immunogen

Affinity purified Rabbit polyclonal Cartilage associated protein antibody

Rabbit polyclonal Stathmin 1 antibody (Ser37)

Affinity purified Rabbit polyclonal Lamin A/C antibody

PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Affinity purified Rabbit polyclonal PDE6D antibody

CKAP4 antibody was raised in Rabbit using Human CKAP4 as the immunogen

Affinity purified Rabbit polyclonal NLRP4G antibody

Rabbit polyclonal elF4E antibody (Ser209)

GRAP2 antibody was raised in Rabbit using Human GRAP2 as the immunogen

LASP1 antibody was raised in Rabbit using Human LASP1 as the immunogen

Affinity purified Rabbit polyclonal SAFB1 antibody

Affinity purified Rabbit polyclonal PRPS1L1 antibody

Rabbit polyclonal PARK2 antibody (Ser101)

Mouse monoclonal CHEK2 antibody

Rabbit polyclonal TH antibody (Ser31)

Factor VIII antibody (HRP) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.

BCL2L1 antibody was raised in rabbit using the N terminal of BCL2L1 as the immunogen

The Caspase 7 antibody is a highly specialized nuclear receptor that plays a crucial role in apoptosis, the process of programmed cell death. This antibody specifically targets and binds to the HER2 protein, making it an effective anti-HER2 antibody. It belongs to the group of polyclonal antibodies, which are derived from multiple B-cell clones and can recognize different epitopes on the target protein.

CXCL12 antibody was raised in rabbit using the middle region of CXCL12 as the immunogen

IGF1R antibody was raised in rabbit using the middle region of IGF1R as the immunogen

H2AFY2 antibody was raised in Rabbit using Human H2AFY2 as the immunogen

Affinity purified Rabbit polyclonal alpha Glucosidase 2 antibody

MIA2 antibody was raised in rabbit using the C terminal of MIA2 as the immunogen

CD28 antibody (PE) was raised in mouse using chicken CD28 as the immunogen.

The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

Rabbit polyclonal OCIAD1 antibody

The STAT3 antibody is a powerful tool used in life sciences research to study the function and activity of the transcription factor STAT3. This antibody specifically recognizes and binds to the phosphorylated form of STAT3, allowing researchers to investigate its role in various cellular processes. The chromatin immunoprecipitation assay can be performed using this antibody to analyze the DNA binding activity of STAT3 and identify its target genes. Additionally, the STAT3 antibody has been shown to inhibit the growth factor-induced transmembrane conductance in certain cell types. It has also been implicated in neuroprotective effects and plays a crucial role in the regulation of cytokine family signaling pathways, such as interleukin-6. With its high specificity and potency, this polyclonal antibody is an essential tool for scientists studying signal transduction pathways mediated by STAT3.

PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Purified Polyclonal RPC antibody

Rabbit polyclonal Integrin beta antibody (Thr788)

KLF7 antibody was raised in Rabbit using Human KLF7 as the immunogen

KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE

Mouse monoclonal KATNB1 antibody

IL6 antibody is an antibody preparation that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory and immune responses. IL-6 plays a critical role in the regulation of hepcidin, an antimicrobial peptide that controls iron metabolism. By neutralizing IL-6, this antibody can modulate hepcidin levels and potentially impact iron homeostasis.

CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.

DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Affinity purified Chicken polyclonal 200 kDa Neurofilament antibody

TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

ISL1 antibody was raised in Rabbit using Human ISL1 as the immunogen

Affinity purified Rabbit polyclonal NPEPPS antibody

Rat monoclonal CD24 antibody (FITC)

CD38 antibody (PE) was raised in rat using CD38 as the immunogen.

CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.

Affinity purified Rabbit polyclonal VATPase C2 antibody

The Caspase 7 antibody is a powerful inhibitory factor used in Life Sciences research. This polyclonal antibody specifically targets the protein caspase 7, which plays a crucial role in programmed cell death (apoptosis). By blocking the activity of caspase 7, this antibody allows researchers to investigate its function and explore its potential as a therapeutic target.

Mouse monoclonal GSTT2 antibody

CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

Rabbit polyclonal Osteopontin antibody (HRP)

CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.

ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen

Affinity purified Rabbit polyclonal MAP2K3 antibody

The ABI1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets and neutralizes the alpha-fetoprotein, c-myc, hemoglobin, protein, collagen, interferon-gamma (IFN-gamma), telomerase, fibronectin, and growth factor. This antibody is widely used in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA). Its high specificity and affinity make it an essential tool for studying the role of these proteins in different biological processes. Whether you are conducting basic research or exploring potential therapeutic targets, the ABI1 antibody will provide valuable insights into cellular functions and signaling pathways. Trust this reliable antibody to enhance your scientific discoveries and advance your understanding of complex biological systems.

Rabbit polyclonal ADCY5 antibody

Rabbit polyclonal SHC antibody (Tyr427)

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

The FGF1 antibody is a powerful globulin that acts as a family kinase inhibitor, specifically targeting endothelial growth. This antibody is widely used in the field of Life Sciences and is highly effective in inhibiting cdk4/6, a crucial enzyme involved in cell cycle regulation. Additionally, the FGF1 antibody has shown remarkable neutralizing properties against caspase-9, an enzyme responsible for initiating apoptosis. With its polyclonal nature, this antibody exhibits high specificity and affinity towards alpha-fetoprotein, making it an ideal tool for research involving adipose tissue. Furthermore, the FGF1 antibody has demonstrated antiviral activity and can effectively target molecules associated with viral infections. Its colloidal formulation ensures stability and ease of use. Researchers also utilize this antibody as an anti-VEGF agent due to its ability to counteract vascular endothelial growth factor.

SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF

Affinity purified Rabbit polyclonal CLN2 antibody

NDUFS3 antibody was raised in Rabbit using Human NDUFS3 as the immunogen

LOH12CR1 antibody was raised in Rabbit using Human LOH12CR1 as the immunogen

Rabbit polyclonal PRKAR2A antibody

Rabbit polyclonal TSPAN6 antibody

Purified Rabbit polyclonal PKA antibody (Thr197)

Rabbit polyclonal SLC25A25 antibody

The Tenascin C antibody is a highly specialized product used in the field of Life Sciences. It is an activated glycoprotein that acts as a growth factor and plays a crucial role in various cellular processes. This antibody is widely used in immunoassays, particularly in the detection and quantification of Tenascin C levels.

Rabbit polyclonal TEX10 antibody

Affinity purified Rabbit polyclonal SDHA antibody

The TAGLN antibody is a monoclonal antibody that acts as an anti-connexin agent. It targets connexin proteins involved in endothelial growth and adipose tissue development. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been used to study the role of connexins in angiogenesis, immune response, and cell signaling pathways. The TAGLN antibody is cytotoxic and has been shown to neutralize certain chemokines and growth factors. It is commonly used in experiments involving human serum and has also been utilized to detect alpha-fetoprotein levels. With its specificity and effectiveness, the TAGLN antibody is a valuable tool for researchers in understanding cellular processes and developing therapeutic interventions.

Mouse monoclonal CD69 antibody (biotin)

CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.

DNALI1 antibody was raised in Rabbit using Human DNALI1 as the immunogen

LAP3 antibody was raised in Rabbit using Human LAP3 as the immunogen

Goat anti Mouse IgG2a secondary antibody (HRP)

Purified Rabbit polyclonal USP35 antibody

IGKV15 antibody was raised in Rabbit using Human IGKV1-5 as the immunogen

Purified Polyclonal Adenylate Cyclase 1 antibody

Goat anti-syrian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.

Rabbit polyclonal CNKR2 antibody

VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Affinity purified Rabbit polyclonal Coronin 1B antibody

CD25 antibody (PE) was raised in rat using alpha chain IL-2 receptor as the immunogen.

Affinity purified Rabbit polyclonal XYLB antibody

GPR18 antibody was raised in rabbit using the middle region of GPR18 as the immunogen

Rat monoclonal Ly6A/E antibody

FAM185A antibody was raised in Rabbit using Human FAM185A as the immunogen

CD45.2 antibody (Spectral Red) was raised in mouse using CD45.2 as the immunogen.

UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY

CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.

Affinity purified Rabbit polyclonal ZNF211 antibody

Monoclonal antibody against α4-integrin

KCTD5 antibody was raised in Rabbit using Human KCTD5 as the immunogen

CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

KRT14 antibody was raised in rabbit using the C terminal of KRT14 as the immunogen

Rabbit polyclonal SYN1 antibody (Ser549)

CTSD antibody was raised in Rabbit using Human CTSD as the immunogen

The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes.

Affinity purified Rabbit polyclonal SPR antibody

Mouse anti Human IgM is a monoclonal antibody that specifically targets human IgM antibodies. It is widely used in the field of life sciences for various applications, including immunohistochemistry, flow cytometry, and ELISA assays. This antibody has high affinity and specificity towards human IgM, making it an essential tool for researchers studying immune responses and antibody-mediated diseases.

Affinity purified Rabbit polyclonal CRLF1 antibody

CA3 antibody was raised in Rabbit using Human CA3 as the immunogen

Affinity purified Rabbit polyclonal ARHGEF18 antibody

Rabbit polyclonal BLOC1 antibody

The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.

Rabbit polyclonal HIST1H4E antibody

TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen

Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.

TFPI2 antibody is a highly specific antibody that targets the TFPI2 molecule. It can be used in various life science applications, including research and diagnostics. This polyclonal antibody has been developed using mass spectrometric methods to ensure its high quality and specificity.

CD25 antibody (PE-CY7) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.

GLRX2 antibody was raised in Rabbit using Human GLRX2 as the immunogen

The L Selectin antibody is a powerful tool for researchers studying actin filaments and protein kinases. This antibody specifically targets L Selectin, a cell surface glycoprotein involved in leukocyte adhesion and migration. By binding to L Selectin, this antibody can inhibit its function and block the interactions between leukocytes and endothelial cells.

RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF

Affinity purified Rabbit polyclonal ZPBP antibody

Rabbit polyclonal CPXM2 antibody

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

CD11b antibody (PE) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.

The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.

Rabbit polyclonal RPS10 antibody

Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.

Affinity purified Rabbit polyclonal SERPINA10 antibody

Rabbit polyclonal PA2G4 antibody

The SLN antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and detect arginase, an enzyme involved in the metabolism of arginine. This antibody recognizes specific glycan structures on the arginase protein, allowing for accurate detection and quantification.

Rabbit polyclonal TNF alpha antibody (biotin)

The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.

FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY

HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.

Rabbit polyclonal CKMT antibody (FITC)

The BCL2 antibody is a monoclonal antibody that specifically targets the BCL2 protein. This protein is involved in regulating cell death and has been implicated in various diseases, including cancer and neurodegenerative disorders. The BCL2 antibody is reactive and neutralizing, meaning it can bind to the BCL2 protein and prevent its activity.

ICAM4 antibody was raised in Rabbit using Human ICAM4 as the immunogen

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.

Rabbit polyclonal Gag-Pol antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Extensive research has demonstrated its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, hindering cell growth in culture.

The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.

TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR

Rabbit polyclonal PCBP4 antibody

CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

ACSL3 antibody was raised in Rabbit using Human ACSL3 as the immunogen

Rabbit polyclonal ADORA2B antibody

The beta Actin antibody is a powerful tool used in the field of Life Sciences for various applications. This antibody specifically targets the beta-actin protein, which plays a crucial role in cellular processes such as cell motility and structure. It is widely used in research to study the expression and localization of beta-actin in different cell types and tissues.

Affinity purified Rabbit polyclonal TXNDC3 antibody

Affinity purified Rabbit polyclonal Edc3 antibody

CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

Affinity purified Rabbit polyclonal SPG7 antibody

SURF6 antibody was raised using the N terminal of SURF6 corresponding to a region with amino acids ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA

Affinity purified Rabbit polyclonal COUP TF1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.

CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.