Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
BCAT1 antibody
The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.
PPM1B antibody
The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.
Lactadherin antibody
The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.
SOD2 antibody
The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.
R3HDM2 antibody
R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
PDIA4 antibody
The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.
ATM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.
HSV1 + HSV2 antibody (biotin)
HSV1/HSV2 antibody (biotin) was raised in rabbit using Strain F as the immunogen.HSF2 antibody
The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.
GST antibody
The GST antibody is a cholinergic monoclonal antibody used in Life Sciences research. It specifically targets and binds to the glutathione S-transferase (GST) protein, which is involved in various cellular processes. This antibody is commonly used in studies related to alpha-fetoprotein, cryptosporidium, adeno-associated virus, activated epidermal growth factor, β-catenin, steroid acetyltransferase, and electrode research. The GST antibody has been extensively tested and validated for its specificity and sensitivity in detecting GST protein in various samples, including human serum. Researchers rely on this antibody to accurately analyze the expression and localization of GST protein in their experiments. Its high-quality performance makes it an essential tool for studying the functions and interactions of GST in different biological systems.
CKMB Antibody
The CKMB Antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target creatine kinase, an enzyme that plays a crucial role in energy metabolism. This antibody is used for immobilization purposes and can be utilized in various research applications.CNPase antibody
The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.
RGS16 antibody
RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
MPP1 antibody
The MPP1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and specifically targets interleukin, an important cytokine involved in various immune responses. This antibody can be used in assays and experiments to detect and measure the levels of interleukin in samples. It is also useful for studying autoantibodies, which are antibodies that target the body's own tissues.
CDK2 antibody
The CDK2 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to cyclin-dependent kinase 2 (CDK2), a protein that plays a crucial role in cell cycle regulation. By binding to CDK2, this antibody can inhibit its activity and prevent cell division.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
CSB antibody
CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.
MELK antibody
The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.
CEA antibody
The CEA antibody is a monoclonal antibody used in Life Sciences. It has pro-angiogenic activity, meaning it promotes the growth of new blood vessels. This antibody can be used in various research applications, such as immunoassays and immunohistochemistry, to detect and quantify CEA (carcinoembryonic antigen) levels. CEA is a protein that is often elevated in certain types of cancer, particularly colorectal cancer. By targeting CEA, this antibody can help researchers better understand the role of CEA in cancer development and progression. Additionally, the CEA antibody has been shown to interact with other proteins, such as annexin A2 and epidermal growth factor, suggesting potential involvement in signaling pathways related to cell growth and proliferation. With its high specificity and sensitivity, the CEA antibody is a valuable tool for studying CEA-related processes and developing diagnostic tests for cancer detection.Collagen Type II antibody
Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.
Thrombospondin antibody
Thrombospondin antibody is a powerful tool used in Life Sciences research to study various biological processes. It specifically targets and detects the presence of thrombospondin, a protein involved in cell growth, angiogenesis, and wound healing. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). By binding to thrombospondin, this antibody allows researchers to investigate its role in different cellular pathways and understand its interactions with other molecules like epidermal growth factor (EGF), alpha-fetoprotein, serotonin, and c-myc. With its high specificity and sensitivity, the thrombospondin antibody provides valuable insights into the molecular mechanisms underlying these processes.
Tim17 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
CYP2E1 antibody
The CYP2E1 antibody is a monoclonal antibody used in life sciences research. It specifically targets the CYP2E1 enzyme, which is primarily found in the liver microsomes. This antibody has been widely used to study the role of CYP2E1 in various physiological processes, including drug metabolism, alcohol metabolism, and oxidative stress. It can be used for immunohistochemistry, western blotting, and other molecular biology techniques to detect and quantify the expression levels of CYP2E1 in different tissues and cell types. The CYP2E1 antibody is highly specific and sensitive, making it an essential tool for researchers studying the function and regulation of this important enzyme.
SGK3 antibody
SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%SEPN1 antibody
SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen
Degré de pureté :Min. 95%Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
INPP5B antibody
The INPP5B antibody is a highly effective substance used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is widely used as a test substance in various research applications. This antibody specifically targets INPP5B, an enzyme involved in the metabolism of inositol phosphates. By inhibiting the activity of INPP5B, this antibody can modulate cellular signaling pathways and provide valuable insights into various cellular processes.
Proteasome 20S LMP7 antibody
Proteasome 20S LMP7 antibody was raised in rabbit using a synthetic peptide, C V(259) E S T D V S D L L H Q Y R E A(274), as the immunogen.Degré de pureté :Min. 95%RHAG antibody
RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
CXCL16 antibody
The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.
Donkey anti Goat IgG (H + L) (biotin)
Donkey anti-goat IgG (H+L) (biotin) was raised in donkey using goat IgG whole molecule as the immunogen.Degré de pureté :Min. 95%Chicken anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.
Degré de pureté :Min. 95%GJA1 antibody
The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.
Endothelin 1 antibody
The Endothelin 1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and has proven to be effective in various applications such as electrophoresis and colloidal techniques. This antibody specifically targets the epidermal growth factor, which is a crucial growth factor involved in many biological processes.
TRKB antibody
The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.
CSA antibody
The CSA antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the circumsporozoite protein (CSP), which is found on the surface of the malaria parasite. This antibody can be used to detect the presence of CSP in samples, making it a valuable tool for studying the biology and transmission of malaria.
TMEM195 antibody
TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
Degré de pureté :Min. 95%MDM1 antibody
MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE
Degré de pureté :Min. 95%E2F4 antibody
The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.
Donkey anti Rabbit IgG (H + L) (biotin)
Donkey anti-Rabbit IgG (H + L) (biotin) was raised in donkey using purified Rabbit IgG (H&L) as the immunogen.Degré de pureté :Min. 95%MEK5 antibody
The MEK5 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to the MEK5 protein, which plays a crucial role in granulosa cell growth and development. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA.
Degré de pureté :Min. 95%CD81 antibody (biotin)
CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.
Degré de pureté :Min. 95%CROT antibody
The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.
SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Degré de pureté :Min. 95%PCT monoclonal antibody
The PCT monoclonal antibody is a cutting-edge product in the field of Life Sciences. It is specifically designed to target and bind to hepatocyte growth factor, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody is produced by hybridoma cells, ensuring high specificity and purity. The PCT monoclonal antibody has been extensively tested and validated for its effectiveness in various applications, including immunohistochemistry, Western blotting, and ELISA assays. Its unique glycosylation pattern ensures optimal performance and stability. This versatile antibody can be used to study the activation of creatine kinase, antibodies against collagen, apical membrane proteins, human folate receptors, and phosphatase activity. With its exceptional quality and reliability, the PCT monoclonal antibody is an essential tool for researchers in the field of Life Sciences.XRCC5 antibody
The XRCC5 antibody is a highly specialized polyclonal antibody that targets the XRCC5 protein. This protein plays a crucial role in DNA repair and recombination processes. The XRCC5 antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry. It has been shown to have antiviral properties by inhibiting the replication of certain viruses. Additionally, this antibody has been found to interact with dopamine receptors and glycoproteins, suggesting its potential involvement in neurotransmission and cell signaling pathways. Furthermore, studies have demonstrated that the XRCC5 antibody can detect the presence of antiphospholipid antibodies in human serum samples, making it a valuable tool for diagnosing autoimmune disorders. Its ability to modulate hormone peptide activity and interfere with the function of certain inhibitors and inhibitory factors further highlights its versatility in research settings.
Protein C antibody
Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
HAO1 antibody
HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
PSME3 antibody
PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Annexin A3 antibody
Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
TST antibody
The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.
ATF3 antibody
The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.
Rabbit anti Chicken IgG (Alk Phos)
Rabbit anti-chicken IgG (Alk Phos) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.
Degré de pureté :Min. 95%LIMK1 antibody
The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.
PCDHAC2 antibody
PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR
Degré de pureté :Min. 95%Salmonella antibody
Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.Goat anti Monkey IgG
Goat anti-monkey IgG was raised in goat using monkey IgG gamma chain as the immunogen.Degré de pureté :Min. 95%Rabbit anti Human IgG (biotin)
Rabbit anti-human IgG (biotin) was raised in rabbit using human IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%SPO11 antibody
The SPO11 antibody is a highly specialized protein that plays a crucial role in the process of DNA recombination during meiosis. It specifically targets and binds to the SPO11 protein, which is responsible for initiating the formation of double-strand breaks in DNA. This antibody has been extensively studied in the field of life sciences and is widely used as a research tool in various applications.
TGFBI antibody
TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
TRIM59 antibody
TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
CAP1 antibody
The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.
SLC5A4 antibody
SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%West Nile virus antibody
The West Nile virus antibody is a monoclonal antibody used in Life Sciences. It binds to specific proteins and inhibits the growth factor GM-CSF, which is involved in the production of white blood cells. This antibody can be used as a research tool for studying the effects of GM-CSF inhibitors on cell growth and differentiation. Additionally, it has been shown to interact with other antibodies, such as transferrin and actin filaments, further expanding its potential applications in various experimental settings. With its ability to modulate colony-stimulating factors and impact cell function, this antibody offers promising opportunities for scientific advancements in the field of immunology and beyond.
TMCC1 antibody
TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK
Degré de pureté :Min. 95%Atrazine antibody
The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.
GRPEL1 antibody
GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
Leiomodin 1 antibody
Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ
Carbonic Anhydrase I antibody
The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.
ROR1 antibody
ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.MCM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
CD56 antibody
CD56 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CD56 antigen, which is expressed on various cell types, including natural killer cells and neural tissues. This antibody is commonly used in studies involving growth factors such as GM-CSF and TGF-β1, as well as colony-stimulating factors. CD56 antibody has been shown to have high affinity and specificity for its target antigen, making it a valuable tool for detecting and analyzing CD56-expressing cells in samples such as human serum or tissue sections. Its binding mechanism involves disulfide bonds, ensuring stable and reliable results. Additionally, this antibody can be utilized in techniques such as immunohistochemistry or flow cytometry to investigate the role of CD56 in various biological processes.GGT2 antibody
GGT2 antibody was raised in rabbit using the N terminal of GGT2 as the immunogen
Degré de pureté :Min. 95%STAT3 antibody
The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Degré de pureté :Min. 95%Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.Lipocalin 12 antibody
Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
Degré de pureté :Min. 95%Lipase antibody (Pancreatic)
Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
CD5 antibody
The CD5 antibody is a monoclonal antibody that targets CD20, a glycoprotein expressed on the surface of B cells. It is widely used in the field of life sciences for research purposes. The CD5 antibody acts as an inhibitor by binding to CD20 and preventing its interaction with other molecules, thus inhibiting B cell activation and proliferation. This antibody can be immobilized on various surfaces for use in assays or experiments. It has been shown to have chemokine-like properties and can induce apoptosis in certain cancer cell lines, such as MCF-7. Additionally, the CD5 antibody can be used in combination with recombinant proteins or other antibodies to create antibody-drug conjugates or for targeted therapy. Its versatility and specificity make it a valuable tool in the field of protein research and drug development.
ILK antibody
The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.
CD117 antibody (Spectral Red)
CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.
Degré de pureté :Min. 95%IL24 antibody
The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.
SERPINB13 antibody
The SERPINB13 antibody is a highly specialized colloidal antibody that belongs to the class of neurotrophic monoclonal antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and binds to SERPINB13, a protein involved in regulating ferritin, phosphatase, glucagon, and growth factor levels. The SERPINB13 antibody has both acidic and neutralizing properties, making it suitable for a range of research purposes. Its high specificity and affinity ensure accurate detection and quantification of SERPINB13 in various biological samples. With its exceptional performance and reliability, this monoclonal antibody is an essential tool for scientists working in diverse research areas.
PARVB antibody
PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVEDegré de pureté :Min. 95%CtBP1 antibody
The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.
Goat anti Rabbit IgG (HRP)
Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%VSIG4 antibody
VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
OLIG2 antibody
The OLIG2 antibody is a highly specific and sensitive tool used in various research applications in the field of Life Sciences. This polyclonal antibody is designed to target OLIG2, a transcription factor that plays a crucial role in the development of the central nervous system.
Cystatin C antibody
Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.DDX50 antibody
DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK
H2AFX antibody
H2AFX antibody was raised using the middle region of H2AFX corresponding to a region with amino acids ELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQE
H2B antibody
The H2B antibody is a polyclonal antibody that has neutralizing properties. It is used in the field of Life Sciences to study various aspects of cellular biology. This antibody specifically targets the interferon-gamma (IFN-gamma) pathway, which plays a crucial role in immune responses and viral infections. The H2B antibody can be used to detect and quantify virus surface antigens, as well as nuclear proteins involved in gene regulation. Additionally, this antibody has been shown to interact with fatty acid-binding proteins and serine proteases, suggesting its involvement in lipid metabolism and protein processing pathways. Whether you need a monoclonal or polyclonal antibody for your research, the H2B antibody is a reliable tool that provides accurate and reproducible results.
Degré de pureté :Min. 95%CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
Tau antibody
The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.
PNMT antibody
The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.
