Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
MST4 antibody
The MST4 antibody is a polyclonal antibody that specifically targets and binds to the triglyceride lipase known as MST4. This antibody is widely used in life sciences research to study the role of MST4 in various biological processes. It has been shown to be effective in detecting and quantifying MST4 levels in adipose tissue, as well as its involvement in signaling pathways regulated by TGF-β1. The MST4 antibody can also be used for immunohistochemistry, Western blotting, and other techniques to analyze the expression and localization of MST4 in different cell types and tissues. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers studying lipase function and related diseases such as obesity and metabolic disorders.
HTR1A antibody
The HTR1A antibody is a highly valuable product in the field of Life Sciences. It plays a crucial role as a heparin cofactor and is used in various medical applications, including as an inhibitor for certain medications. Additionally, this antibody has been found to have significant effects on fetal hemoglobin and autoantibodies.
Homer antibody
The Homer antibody is a growth factor that is commonly found in human serum. It is widely used in Life Sciences research and has been shown to have neutralizing effects on various nuclear factors. The antibody can be used for both in vitro and in vivo experiments, making it a versatile tool for researchers. It is available as both monoclonal and polyclonal antibodies, allowing for flexibility in experimental design. The Homer antibody has been extensively studied for its role in inhibiting the activity of mesothelin, a protein involved in cancer progression. Additionally, it has shown potential as an inhibitor of fibrinogen, collagen, and alpha-fetoprotein. Its antiviral properties make it a valuable asset in the field of virology research. With its wide range of applications and proven efficacy, the Homer antibody is a must-have for any researcher looking to advance their scientific understanding.
SLC5A4 antibody
SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of Ibuprofen, a nonsteroidal anti-inflammatory drug (NSAID). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The antibody specifically binds to Ibuprofen, leading to its neutralization and preventing it from exerting its anti-inflammatory effects.
CHK2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.
alpha 2 Antiplasmin antibody
alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.
Fibronectin antibody
The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.
COX4 antibody
The COX4 antibody is a highly specialized antibody that targets the COX4 protein. This protein plays a crucial role in various biological processes, including energy production and cellular respiration. The COX4 antibody is widely used in life sciences research to study the function and regulation of this important protein.
Calreticulin antibody
Calreticulin antibody was raised in Mouse using synthetic peptide corresponding to aa (EEEDVPGQAKDELC) of human Calreticulin, conjugated to KLH as the immunogen.NARG1 antibody
NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT
SLC11A1 antibody
SLC11A1 antibody was raised using the C terminal of SLC11A1 corresponding to a region with amino acids VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT
uPAR antibody
The uPAR antibody is a monoclonal antibody that has cytotoxic properties and is used as a medicament in multidrug therapy. It targets the plasminogen activator receptor (uPAR) on the surface of cells, inhibiting its function and preventing the activation of collagen-degrading enzymes such as urokinase plasminogen activator (uPA). This antibody has been shown to be effective in treating various diseases and conditions, including cancer, thrombocytopenia, and alpha-fetoprotein-related disorders. In the field of Life Sciences, uPAR antibodies are widely used for research purposes, such as studying cell signaling pathways and growth factors. Whether you need a polyclonal or monoclonal antibody, our high-quality uPAR antibodies are designed to meet your specific research needs.
MUC13 antibody
The MUC13 antibody is a highly specialized antibody that targets the tyrosine-rich region of the MUC13 protein. It is commonly used in Life Sciences research to study multidrug resistance, glycation processes, and the role of MUC13 in various cellular pathways. This antibody has been shown to interact with key proteins such as E-cadherin, circumsporozoite protein, nuclear β-catenin, and growth factors. Additionally, it has demonstrated cytotoxic activity against specific cell lines and has potential antiviral properties. The MUC13 antibody is available as both polyclonal and monoclonal antibodies, making it a versatile tool for researchers in various fields.
Tau antibody
The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.
Ferritin antibody
The Ferritin antibody is a cytotoxic monoclonal antibody that targets annexin A2, a protein involved in cell growth and signaling. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used for the detection and quantification of ferritin, a key iron storage protein, in biological samples. Additionally, this antibody has been used in research to investigate the role of annexin A2 in insulin regulation, as well as its potential as a therapeutic target for diseases such as cancer. The Ferritin antibody is highly specific and can be easily conjugated with streptavidin or other molecules for different experimental setups. Its high affinity towards annexin A2 makes it an excellent tool for studying the interactions between this protein and other molecules such as growth factors or hormones like glucagon. Researchers can utilize this antibody to explore the mechanisms underlying cellular processes and gain valuable insights into various biological pathways.Clostridium difficile Toxin A antibody
The Clostridium difficile Toxin A antibody is a monoclonal antibody that specifically targets the toxin produced by Clostridium difficile bacteria. This antibody is derived from human proteins and contains specific amino acid residues that have been activated to enhance its binding affinity. It works by neutralizing the effects of the toxin, which includes damaging the intestinal lining and causing inflammation.
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to alkaline phosphatase, an enzyme that plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.
CLIC6 antibody
CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
CD8 antibody (Spectral Red)
CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.
ARPC2 antibody
The ARPC2 antibody is a growth factor that plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target and neutralize anti-dnp antibodies. The ARPC2 antibody has been extensively studied and proven effective in laboratory experiments using electrodes. Additionally, it has shown promising results in combination therapy with other antibodies such as trastuzumab, targeting the epidermal growth factor receptor.
STOML1 antibody
The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.
RAGE antibody
The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.
Androgen Receptor antibody
The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.
STEAP1 antibody
The STEAP1 antibody is a highly specialized antibody that targets the phosphatase STEAP1. This antibody has cytotoxic properties and has been shown to disrupt actin filaments, leading to cell death. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. In the field of Life Sciences, this antibody is widely used for its neutralizing effects on STEAP1 activity. The monoclonal antibody variant has been specifically designed to be activated upon binding to STEAP1, ensuring optimal performance in immunoassays. With its high affinity and specificity, this antibody can be used in various applications such as Western blotting, immunofluorescence, and flow cytometry. Researchers can rely on the STEAP1 antibody to accurately detect and measure the levels of this important glycoprotein in their experiments.
alpha Actinin 2 antibody
alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD
KIFAP3 antibody
KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
LGALS3BP antibody
The LGALS3BP antibody is a highly specialized monoclonal antibody that targets the fatty acid cyclase-activating protein (LGALS3BP). It is designed to specifically bind to LGALS3BP and neutralize its activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
SOX2 antibody
The SOX2 antibody is a highly specific and reliable tool used in immunohistochemistry and other life science research applications. This monoclonal antibody binds to the SOX2 antigen, which is a nuclear DNA-binding protein involved in the regulation of embryonic development and cell differentiation. The SOX2 antibody has been extensively validated for its performance in various experimental techniques, including electrochemical impedance spectroscopy.
Transferrin antibody
Transferrin antibody is a monoclonal antibody that specifically targets and neutralizes transferrin, a protein complex involved in the transport of iron in the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has the ability to bind to transferrin with high affinity, preventing its interaction with receptors and inhibiting iron uptake by cells. This can be particularly useful in conditions where excessive iron accumulation is detrimental, such as certain types of cancer or neurodegenerative diseases. Additionally, transferrin antibody has been explored for its potential use in diagnostic assays, as it can detect and quantify transferrin levels in biological samples. Its unique properties make it a valuable tool for researchers working on understanding the role of transferrin and its associated pathways in health and disease.
VAPA antibody
The VAPA antibody is a neutralizing anti-CD33 antibody that is widely used in the field of Life Sciences. It is commonly employed in immunohistochemistry studies to detect and analyze the expression of CD33, a cell surface protein involved in various cellular processes. This antibody specifically targets and binds to CD33, blocking its activity and preventing its interaction with other molecules.
CD19 antibody
CD19 antibody was raised in Mouse using a purified recombinant fragment of human CD19 expressed in E. coli as the immunogen.
ARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
IL13 antibody
The IL13 antibody is a monoclonal antibody that specifically targets and binds to interleukin-13 (IL-13), a growth factor involved in various inflammatory processes. This antibody can effectively neutralize the activity of IL-13 by preventing its interaction with its binding proteins. IL13 antibody has been extensively studied in the field of life sciences and has shown promising results in the treatment of autoimmune diseases, such as asthma and allergic rhinitis.
TMED2 antibody
The TMED2 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the TMED2 protein, which is involved in the transport of cargo proteins between the endoplasmic reticulum and Golgi apparatus. This antibody has been extensively studied in Life Sciences research and has shown promising results in understanding cellular mechanisms.
SLC1A5 antibody
SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
Rat anti Mouse IgA (biotin)
Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.
Filamin B antibody
The Filamin B antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets Filamin B, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.
RALY antibody
RALY antibody was raised using the C terminal of RALY corresponding to a region with amino acids GGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDT
NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
DDT antibody
The DDT antibody is a highly specialized monoclonal antibody that targets and binds to DDT (dichlorodiphenyltrichloroethane), a pesticide commonly used in the past. This antibody exhibits high specificity and affinity for DDT, making it an effective tool for research and diagnostic applications.
Caspase 3 antibody
The Caspase 3 antibody is a highly specific monoclonal antibody that targets the caspase 3 protein. Caspase 3 is an important enzyme involved in programmed cell death, also known as apoptosis. This antibody is widely used in life sciences research to study the role of caspase 3 in various cellular processes.
CRP antibody
The CRP antibody is a highly versatile and effective tool for research in the field of immunology. It is designed to specifically target and neutralize C-reactive protein (CRP), a key component of the immune response. This monoclonal antibody has been extensively tested and proven to have high affinity and specificity for CRP.
GNB2 antibody
GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR
ASL antibody
The ASL antibody is a monoclonal antibody that is specifically designed to target and bind to the antigen ASL. This antibody is produced by hybridoma cells, which are created by fusing myeloma cells with B cells that have been immunized with the ASL antigen. The resulting hybridoma cell strain produces large quantities of this specific antibody.
AXL antibody
AXL antibody was raised in Mouse using a purified recombinant fragment of AXL(aa466-530) expressed in E. coli as the immunogen.
FAM126A antibody
The FAM126A antibody is a highly specific monoclonal antibody that targets the FAM126A protein. This antibody has been developed for use in various applications, including immunohistochemistry, Western blotting, and ELISA. It acts as an inhibitory factor by neutralizing the activity of FAM126A.
CASC3 antibody
CASC3 antibody was raised using the N terminal of CASC3 corresponding to a region with amino acids MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPS
TMPRSS4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp technique, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its unique mechanisms of action and potent properties, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is
Fascin 1 antibody
The Fascin 1 antibody is a highly specialized monoclonal antibody that targets and binds to the protein Fascin 1. Fascin 1 is involved in various cellular processes, including cell adhesion, migration, and cytoskeletal organization. This antibody has been extensively studied in Life Sciences research and has shown inhibitory properties against Fascin 1 activity.
Myc antibody
The Myc antibody is a monoclonal antibody that specifically targets the protein Myc. It belongs to the family of kinase inhibitors and is widely used in Life Sciences research. This antibody has shown high affinity for Myc, making it a valuable tool for studying the functions and interactions of this protein.
NAGS antibody
NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
SDHB antibody
The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.
Villin antibody
The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
IL13RA2 antibody
IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
AQP8 antibody
The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.
CLP1 antibody
The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.
NQO1 antibody
The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.
RANKL antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive human activity studies using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, such as ESX-1 secretion system protein, effectively inhibiting cell growth in culture.
KCNC1 antibody
KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
EDG1 antibody
The EDG1 antibody is a highly specialized monoclonal antibody that targets activated EDG1 receptors, which are an endoplasmic reticulum marker. This antibody has been extensively studied and proven to be effective in various research applications. It has been used in studies related to oxygen therapy, where it was found to modulate the expression of interleukin-6 (IL-6). The binding specificity and affinity of this antibody have been confirmed using mass spectroscopy and other advanced techniques.
GPT antibody
GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
MUC16 antibody
The MUC16 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets MUC16, also known as CA125, which is a transmembrane glycoprotein that is overexpressed in various types of cancer. By binding to MUC16, this antibody can exert cytotoxic effects on cancer cells and inhibit their growth.
PDK4 antibody
The PDK4 antibody is a powerful tool used in the field of Life Sciences. It is an autoantibody that specifically targets and binds to the nuclear phosphatase known as PDK4. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA).
DDX39 antibody
DDX39 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 39 (Ddx39)KLRC1 antibody
The KLRC1 antibody is a polyclonal antibody that specifically targets the chemokine-activated receptor KLRC1. This antibody is commonly used in life sciences research and has been shown to have high affinity and specificity for KLRC1. It can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA. The KLRC1 antibody has been proven effective in detecting KLRC1 expression in human serum samples and has been used to study its role in various biological processes. This antibody has also been utilized in the development of therapeutic inhibitors targeting KLRC1 signaling pathways. With its reliable performance and versatility, the KLRC1 antibody is an essential tool for researchers studying protein kinases and their associated pathways.
Neuropsin antibody
The Neuropsin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activated form of Neuropsin, an enzyme involved in various physiological processes. This antibody has been shown to inhibit the activity of Neuropsin, which plays a crucial role in fatty acid metabolism and the regulation of inflammatory responses.
SNRPB antibody
SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG
RALA antibody
The RALA antibody is a glycopeptide that acts as an anticoagulant by neutralizing the viscosity of fibrinogen. It belongs to the class of peptide agents known as antibodies, which are widely used in Life Sciences research. This antibody specifically binds to glycan-binding proteins and has been shown to have toxic effects on various cell types. Additionally, it has been found to inhibit the activity of colony-stimulating factors such as interleukin-6, making it a valuable tool for studying immune responses and cell signaling pathways. The RALA antibody is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein, increasing its versatility in experimental applications.
PKC alpha antibody
The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.
FBXL5 antibody
FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
Factor V antibody
Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.
KSHV K8 alpha antibody
KSHV K8 alpha antibody was raised in Mouse using a purified recombinant fragment of KSHV K8alpha expressed in E. coli as the immunogen.TUB antibody
The TUB antibody is a monoclonal antibody that specifically targets the nuclear protein known as TUB. This antibody has been extensively tested and is proven to be highly effective in detecting TUB in human serum and MCF-7 cells. TUB is a crucial protein involved in various cellular processes, including hormone peptide synthesis, glucagon regulation, and tyrosine metabolism. Additionally, this antibody can be used in research applications such as immunohistochemistry and western blotting. Its high specificity and sensitivity make it a valuable tool for studying TUB-related diseases and exploring potential therapeutic interventions. Furthermore, the TUB antibody can be used in combination with other antibodies, such as anti-CD20 antibodies or alpha-fetoprotein antibodies, to enhance its detection capabilities. With its wide range of applications and reliable performance, the TUB antibody is an essential tool for researchers studying proteins involved in cellular signaling pathways, glycoprotein synthesis, amyloid plaque formation, and chemokine regulation.
MBP antibody
The MBP antibody is a monoclonal antibody that targets β-catenin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of β-catenin. It can be used for immunohistochemistry, western blotting, and other experimental techniques.
UBE2L6 antibody
UBE2L6 antibody was raised using the N terminal of UBE2L6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL
RPLP0 antibody
RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
