Anticorps primaires

RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITA

The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.

PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR

The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.

Rabbit polyclonal SQLE antibody

EPS15L1 antibody was raised in Rabbit using Human EPS15L1 as the immunogen

PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CASP3 antibody was raised in Rabbit using Human CASP3 as the immunogen

Rat monoclonal NGAL antibody (Biotin)

Affinity purified Rabbit polyclonal FMNL1 antibody

Rabbit polyclonal GRM5 antibody

IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.

SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen

Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.

Purified Polyclonal LMX1B antibody

TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

Rabbit polyclonal GABRG2 antibody (Ser327)

Affinity purified Rabbit polyclonal TSPYL1 antibody

GRID1 antibody was raised in Rabbit using Human GRID1 as the immunogen

Affinity purified Rabbit polyclonal PECR antibody

Rabbit polyclonal 14-3-3 zeta theta antibody (Thr232)

Mouse monoclonal MVK antibody

ECEL1 antibody was raised in Rabbit using Human ECEL1 as the immunogen

The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.

FBXO8 antibody was raised in Rabbit using Human FBXO8 as the immunogen

WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen

Rabbit polyclonal QRSL1 antibody

Rabbit polyclonal NDUFA1 antibody

IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP

Rabbit polyclonal Mevalonate Kinase antibody

Rabbit polyclonal STOML3 antibody

The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.

KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen

Delangin B antibody was raised in Rat using Delangin peptide coupled carrier protein as the immunogen.

Affinity purified Rabbit polyclonal NCKAP1 antibody

Goat anti-human lambda chain (biotin) was raised in goat using human l lambda chain as the immunogen.

Affinity purified Rabbit polyclonal alpha Glucosidase II antibody

Rabbit polyclonal ARPC2 antibody (biotin)

Affinity purified Rabbit polyclonal C9orf78 antibody

Affinity purified Rabbit polyclonal SEPT7 antibody

ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

Coronavirus Nucleoprotein (NP) monoclonal antibody

Insulin antibody is a highly specialized product used in Life Sciences research. It is an activated polyclonal antibody that specifically targets insulin. This antibody is widely used in immunohistochemistry studies to detect and visualize insulin expression in tissues. It has also been shown to have neutralizing activity against insulin, making it a valuable tool for studying the role of insulin in various biological processes.

Rabbit polyclonal cJun antibody

Rabbit polyclonal PKC pan antibody (Thr497)

The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.

Rabbit polyclonal TMEM50B antibody

The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.

The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the

Rabbit polyclonal RPS6KC1 antibody

Affinity purified Rabbit polyclonal Histone H2A.Z antibody

Affinity purified Rabbit polyclonal HSPE1 antibody

The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.

The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.

Affinity purified Rabbit polyclonal DRD3 antibody

NCKIPSD antibody was raised in Rabbit using Human NCKIPSD as the immunogen

The Angiotensinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize angiotensinogen, a protein that plays a key role in the regulation of blood pressure and fluid balance in the body. This antibody has been extensively studied and proven to be effective in blocking the activation of angiotensinogen, thereby preventing its interaction with other molecules such as atrial natriuretic peptide and albumin.

Affinity purified Rabbit polyclonal Cish antibody

Rabbit polyclonal UQCRFS1 antibody

Affinity purified Rabbit polyclonal SCN1B antibody

Affinity purified Rabbit polyclonal VPS37C antibody

The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.

Affinity purified Rabbit polyclonal DAP5 antibody

Affinity purified Rabbit polyclonal Phospho-ORF50 antibody

FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen

Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.

The NOS2 antibody is a highly specialized autoantibody that targets the glycan structure of the EBNA1 protein. This polyclonal antibody is derived from plasmids and has been extensively studied for its genotoxic effects. It specifically recognizes and binds to the NOS2 protein, an important enzyme involved in nitric oxide production. The NOS2 antibody can be used in various life science applications, including research on interferon and interleukin-6 signaling pathways. Additionally, it is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their specific needs. Trust in the reliability and specificity of this antibody to enhance your experiments in the field of life sciences.

Affinity purified Rabbit polyclonal ATP6V0A2 antibody

Mouse monoclonal RPN1 antibody

The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.

Rabbit polyclonal PPP1R11 antibody (FITC)

The IL3 antibody is a monoclonal antibody that has cytotoxic properties and is used in the field of Life Sciences. It specifically targets the chemokine angptl3 and acts as a neutralizing agent. This monoclonal antibody inhibits the growth factor activity of angptl3, which is a glycoprotein involved in adipose tissue regulation. By blocking the function of angptl3, this antibody can potentially be used as a therapeutic tool for various conditions related to adipose tissue dysfunction. The IL3 antibody is widely recognized in the scientific community for its high specificity and potency, making it an essential tool for researchers studying the role of angptl3 in different physiological processes. In addition to its use in research, this antibody also has potential applications in clinical settings for targeted therapy against diseases associated with dysregulated adipose tissue.

Rabbit polyclonal RASD2 antibody

Affinity purified Rabbit polyclonal UNC13B antibody

The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.

PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ

The purified Mouse IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

Rabbit polyclonal CEB alpha antibody (Ser21)

The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.

The Plasminogen antibody is a growth factor that plays a crucial role in various biological processes. It contains acid residues that enable it to bind to fibrinogen and exert its proteolytic activity. This Polyclonal Antibody can specifically recognize and bind to the Plasminogen antigen, leading to the formation of antigen-antibody complexes. These complexes have been shown to have various biological effects, including the regulation of hepatocyte growth and the modulation of microvessel density.

CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen

The AMPK alpha antibody is a high-quality polyclonal antibody that is used in life sciences research. It specifically targets AMP-activated protein kinase (AMPK) alpha subunit and can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation.

MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII

Rabbit polyclonal Wheat Gliadin antibody

This Affinity Purified Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as capture or detection antibody in various immunoassays. Please inquire for bulk pricing or custom conjugations.

FBXW11 antibody was raised in Rabbit using Human FBXW11 as the immunogen

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

The EGFR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), a protein that plays a crucial role in cell growth and division. This antibody can be used in various applications, such as chemiluminescent immunoassays, where it enables the detection and quantification of EGFR levels in samples.

ACYP1 antibody was raised in Rabbit using Human ACYP1 as the immunogen

Affinity purified Rabbit polyclonal NMDAR2A antibody

HOXC9 antibody was raised in mouse using recombinant Homeo Box C9

The GHRHR antibody is a powerful inhibitor that targets the TRPV4 channel, making it an effective medicament for various applications. This antibody specifically inhibits the activity of serine proteases, reducing the risk of excitotoxicity and protecting cells from damage. It has been widely used in the field of life sciences as a diagnostic agent to detect specific proteins such as myoglobin, fibrinogen, and MIP-1β. Additionally, this antibody has shown promising results in pluripotent stem cell research by regulating lactate production and promoting cell differentiation. With its multifaceted properties and diverse applications, the GHRHR antibody is a valuable tool for researchers and medical professionals alike.

Affinity purified Rabbit polyclonal IPMK antibody

COX18 antibody was raised in Rabbit using Human COX18 as the immunogen

Affinity purified Rabbit polyclonal Laminin gamma 2 antibody

CD24 antibody (PE) was raised in rat using murine heat stable antigen as the immunogen.

TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.

Rabbit polyclonal BTF3L3 antibody

Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

CD5 antibody (PE) was raised in rat using CD5/Lyt-1 as the immunogen.

BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.

The HSF1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes arginase, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in blocking the activity of arginase, allowing researchers to investigate its role in different biological systems.

The ITGB3 antibody is a highly specialized product that is used in the field of Life Sciences. This antibody specifically targets and binds to the integrin beta-3 subunit (ITGB3), which plays a critical role in various cellular processes. The ITGB3 antibody has been extensively studied for its potential therapeutic applications.

GAD65 antibody is a polyclonal antibody that is commonly used in Life Sciences research. This antibody specifically targets the enzyme glutamate decarboxylase 65 (GAD65). GAD65 plays a crucial role in the synthesis of gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter in the central nervous system. The cytotoxic effects of GAD65 antibodies have been studied in various research models, including androgen-treated prostate cancer cells, where it was found to inhibit cell proliferation and induce apoptosis.

The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.

RETNLB antibody was raised in rabbit using the N terminal of RETNLB as the immunogen

Rabbit polyclonal AGRN antibody

SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG

Affinity purified Rabbit polyclonal RARRES3 antibody

Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Mouse monoclonal NGAL antibody (Biotin)

CXCL9 antibody was raised in rabbit using the middle region of CXCL9 as the immunogen

Factor X antibody (HRP) was raised in goat using human Factor X purified from plasma as the immunogen.

Goat anti Human IgE antibody

TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG

The MOR antibody is a monoclonal antibody that specifically targets the mu-opioid receptor (MOR). This receptor plays a crucial role in mediating the effects of opioids and is involved in pain management and addiction. The MOR antibody has high affinity and specificity for the MOR, making it an excellent tool for studying opioid signaling pathways and developing new therapeutic strategies.

Rabbit polyclonal PTGES2 antibody

The SPARC antibody is a highly reactive and neutralizing monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the SPARC protein, which plays a crucial role in various cellular processes such as cell adhesion, migration, and proliferation. This antibody can be used for intraocular applications, as well as in vitro experiments involving chemokine signaling pathways, fatty acid metabolism, fibroin synthesis, and telomerase activity. Additionally, the SPARC antibody has been shown to have potential therapeutic applications in regenerative medicine due to its ability to interact with mesenchymal stem cells and modulate their behavior. Whether you need a recombinant antigen or polyclonal antibodies for your research, the SPARC antibody is an essential tool that can provide valuable insights into cellular mechanisms and contribute to advancements in the field of Life Sciences.

CYP46A1 antibody was raised in Rabbit using Human CYP46A1 as the immunogen

Biotin Conjugated Rabbit anti-Goat IgG h+l antibody.

ICAM4 antibody was raised in Rabbit using Human ICAM4 as the immunogen

LDL receptor antibody (biotin) was raised in rabbit using a specific synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.

TH antibody is a monoclonal antibody that targets the growth factor known as epidermal growth factor (EGF). It specifically binds to EGF and inhibits its activity, making it an effective tool for research in the field of Life Sciences. This antibody has been used in various studies to investigate the role of EGF in different biological processes. Additionally, TH antibody has shown neuroprotective properties by reducing dopamine levels in the brain. It can be used in experiments involving electrode recordings or binding protein analysis. Whether you're studying cell signaling pathways or developing new therapeutic approaches, TH antibody is a valuable tool for your research.

Rabbit polyclonal URM1 antibody

FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

HDLBP antibody was raised in Rabbit using Human HDLBP as the immunogen

Affinity purified Rabbit polyclonal COUP TF1 antibody

CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK

MPP7 antibody was raised in Rabbit using Human MPP7 as the immunogen

The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.

Affinity purified Rabbit polyclonal Calpain 5 antibody

MARVELD2 antibody was raised in Rabbit using Human MARVELD2 as the immunogen

HEXA antibody is a highly specific and potent polyclonal antibody used in life sciences research. It is also available as a monoclonal antibody. This antibody specifically targets the natriuretic hormone peptide, TGF-beta, and has neutralizing properties. It can be used to study the role of these hormones in various biological processes. Additionally, HEXA antibody has cytotoxic effects on cells expressing certain growth factors, making it a valuable tool for studying cell signaling pathways. Moreover, this antibody can be used in studies related to lipid metabolism as it targets enzymes such as triglyceride lipase and lipoprotein lipase. Its wide range of applications makes HEXA antibody an essential component of any research project in the fields of life sciences and medicine.

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

The TIMP2 antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing molecule. It is a neutralizing antibody that has been extensively studied in the field of Life Sciences. This antibody has shown great potential in inhibiting endothelial growth and angiogenesis, making it a valuable tool for research in the field of cancer biology and tumor development. Additionally, the TIMP2 antibody has been used to detect alpha-fetoprotein levels in human serum, making it an important tool for diagnostic purposes. With its high specificity and affinity for its target molecule, this antibody offers great promise for further advancements in the understanding and treatment of various diseases.

The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.

Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.

CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.

The PERK antibody is a polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the activated form of PERK (protein kinase RNA-like endoplasmic reticulum kinase). This monoclonal antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

The API5 antibody is an adeno-associated polypeptide that has the ability to bind to antigenic proteins and inhibit their activity. It is commonly used as a research tool in the development of inhibitors for various diseases. The API5 antibody has been shown to have a high affinity for heparin, which makes it an effective compound for inhibiting heparin cofactor activity. Additionally, this antibody can be used in the production of polyclonal antibodies, which are essential tools in biomedical research. It is also known to have autoantibodies properties and can be utilized in the development of medicines targeting serotonin-related disorders.

Rabbit polyclonal Ferritin heavy chain antibody (FITC)

Affinity purified Rabbit polyclonal Protease Inhibitor 15 antibody

E2F1 antibody was raised in rabbit using the C terminal of E2F1 as the immunogen

AMY2A antibody was raised in Rabbit using Human AMY2A as the immunogen

RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Rabbit polyclonal EPHB2 antibody (Tyr298)

TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE

Affinity purified Rabbit polyclonal PSKH1 antibody

Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.

Phosphotyrosine antibody was raised in rabbit using Iodoacetylphosphotyrosine-KLH conjugate as the immunogen.

Scamp5 antibody was raised in rabbit using the C terminal of Scamp5 as the immunogen

Rabbit polyclonal RRAS2 antibody

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.

MYOZ2 antibody was raised in Rabbit using Human MYOZ2 as the immunogen

OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

CDK3 antibody was raised in rabbit using the C terminal of CDK3 as the immunogen

PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

The BRCA1 antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results in various experiments, including phorbol-induced differentiation and interferon-mediated signaling pathways. This monoclonal antibody has been used for neutralizing experiments, electrophoresis, and as an electrode in various research studies. The BRCA1 antibody is produced using a state-of-the-art lyophilization method to ensure its stability and efficacy. It is also available as an anticoagulant for specific applications. This antibody is highly specific and can be used to detect autoantibodies or as a tool for studying the expression of BRCA1 protein in different tissues.

Keratin hHa5 antibody was raised in guinea pig using a synthetic peptide of human hair (trichocytic) keratin hHa5 coupled to KLH as the immunogen.

Rabbit polyclonal PYGB antibody

The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.

CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

Rat PMN antibody (FITC) was raised in rabbit using rat PMNs as the immunogen.

The FLAG Tag antibody is a protein complex that consists of Polyclonal Antibodies. It has neutralizing properties and can target specific growth factors. This antibody is used in the field of Life Sciences to detect and analyze proteins in various research applications. The FLAG Tag antibody is designed to bind to the FLAG tag, which is a small peptide sequence that can be added to recombinant proteins for easy detection and purification. The antibody recognizes this tag and forms a stable complex with the protein of interest. This antibody is highly specific and exhibits low cross-reactivity with other proteins, making it an ideal tool for protein analysis. It can be used in various techniques such as Western blotting, immunoprecipitation, and immunofluorescence. In addition to its research applications, the FLAG Tag antibody also has potential therapeutic uses. It can be utilized as a medicament in the treatment of certain diseases where targeting specific proteins or growth factors is beneficial. The FLAG Tag antibody is produced using advanced techniques that

Rabbit polyclonal GPRASP1 antibody

TFPI antibody was raised in sheep using Synthetic peptide corresponding to NH-terminus of human TFPI conjugated to carrier as the immunogen.

IRF2BP1 antibody was raised using the middle region of IRF2BP1 corresponding to a region with amino acids LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQ

ZNF565 antibody was raised in rabbit using the middle region of ZNF565 as the immunogen