Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
Mouse RBC antibody (FITC)
Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.
PNPase antibody
The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.
ZNF286 antibody
ZNF286 antibody was raised in rabbit using the C terminal of ZNF286 as the immunogenDegré de pureté :Min. 95%SLC6A1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting potent bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, hindering transcription and replication processes in bacteria. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.
CPVL antibody
The CPVL antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets epidermal growth factor (EGF) and chemokine receptors, making it an essential tool for researchers studying these signaling pathways. In addition to its polyclonal form, monoclonal antibodies are also available for more specific applications.
CTGF antibody
CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.
Degré de pureté :Min. 95%MCM5 antibody
The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.
USP33 antibody
USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%EPS8L1 antibody
EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE
USP10 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
CDH1 antibody
CDH1 antibody was raised in Mouse using a purified recombinant fragment of human CDH1 expressed in E. coli as the immunogen.GLP1 antibody
The GLP1 antibody is a highly effective inhibitor that targets human serum and inhibitory factors, such as leukemia inhibitory factor. It is an antibody specifically designed to neutralize the activity of GLP1, which is a hormone peptide involved in various physiological processes. This monoclonal antibody has been extensively studied and proven to be cytotoxic against specific cell types. Its unique mechanism of action involves binding to GLP1 receptors and interfering with downstream signaling pathways. The GLP1 antibody has shown promising results in preclinical studies and holds great potential for therapeutic applications in the field of Life Sciences.DPPA5 antibody
DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Connexin 43 antibody
The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.
ID4 antibody
The ID4 antibody is a highly specialized product used in the field of Life Sciences. It is commonly employed in chromatographic techniques and immobilization processes. This antibody specifically targets angptl3, a growth factor protein involved in various biological processes such as collagen production and cell growth. The ID4 antibody is known for its neutralizing properties, effectively inhibiting the activity of angptl3 dimers.
TRMT5 antibody
TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT
Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.
COL8A2 antibody
COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen
Degré de pureté :Min. 95%TNF alpha antibody
TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.RGS3 antibody
RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
WWP1 antibody
WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Degré de pureté :Min. 95%LLO antibody
The LLO antibody is a high-quality monoclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize superoxide, a highly reactive oxygen species that can cause damage to cells and tissues. This antibody has a high specific activity and exhibits low density, making it an ideal choice for various applications such as enzyme-linked immunosorbent assays (ELISA), Western blotting, and immunohistochemistry.METTL1 antibody
METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
HSV1 + HSV2 antibody (biotin)
HSV1/HSV2 antibody (biotin) was raised in rabbit using Strain F as the immunogen.RHBDL2 antibody
RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
Degré de pureté :Min. 95%Rabbit anti Mouse IgG2b (HRP)
Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.
CD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
Degré de pureté :Min. 95%DHX58 antibody
DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
ASL antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.
AQP4 antibody
The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.
ABHD7 antibody
ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
Degré de pureté :Min. 95%p70S6 Kinase antibody
The p70S6 Kinase antibody is a highly effective selectable marker used in various research applications. This antibody is designed to specifically target and bind to p70S6 Kinase, a key enzyme involved in the regulation of protein synthesis and cell growth. It is available as both monoclonal and polyclonal antibodies, providing researchers with options depending on their specific needs.
Degré de pureté :Min. 95%HIST2H2AC antibody
HIST2H2AC antibody was raised using the middle region of HIST2H2AC corresponding to a region with amino acids IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK
B3GALT1 antibody
B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI
Degré de pureté :Min. 95%ATM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.
Dynamin 1 antibody
Dynamin 1 antibody was raised using the middle region of DNM1 corresponding to a region with amino acids PPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPA
PBLD antibody
The PBLD antibody is a highly specific monoclonal antibody that targets the chemokine receptor PBLD. It plays a crucial role in the regulation of various immune responses, including the activation and migration of immune cells. The PBLD antibody has been extensively studied for its potential therapeutic applications in cancer immunotherapy and autoimmune diseases.
PCNP antibody
The PCNP antibody is a highly specialized and versatile product used in the field of Life Sciences. This antibody is derived from adeno-associated virus and has been pegylated for enhanced stability and efficacy. It specifically targets actin filaments, which play a crucial role in various cellular processes.
RBP1 antibody
The RBP1 antibody is a highly specialized polyclonal antibody that is used in various life sciences assays. It is specifically designed to target and bind to the RBP1 protein, which plays a crucial role in glucose transportation and dopamine regulation. This antibody is produced by immunizing animals with the specific antigen, resulting in the generation of high-affinity antibodies that can recognize and bind to the target protein.
FGFR2 antibody
The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.
Amylin antibody
The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.
Rabbit anti Human IgG (Texas Red)
Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.
Degré de pureté :Min. 95%4EBP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
CD23 antibody
CD23 antibody is a monoclonal antibody that specifically targets the CD23 protein, a molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study the function and regulation of CD23. It can be used to detect and quantify CD23 expression levels in cells or tissues, providing valuable insights into its role in different physiological and pathological conditions. Additionally, CD23 antibody has been shown to inhibit the activity of derivatives such as ferritin and fibrinogen, suggesting its potential therapeutic applications in oxidative damage and inflammatory disorders. Furthermore, this antibody has been found to modulate hepatocyte growth factor and collagen synthesis, indicating its involvement in tissue repair and regeneration processes. With its high specificity and versatility, CD23 antibody is an indispensable tool for researchers studying various aspects of cellular signaling pathways and molecular interactions involving CD23.
GFPT2 antibody
GFPT2 antibody was raised in rabbit using the N terminal of GFPT2 as the immunogen
Degré de pureté :Min. 95%ETFA antibody
ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
AFP antibody
AFP antibody was raised in mouse using purified human alpha-fetoprotein as the immunogen.
Clostridium difficile toxin A antibody
Clostridium difficile toxin A antibody is a highly specialized antibody that specifically targets the cytotoxic molecule produced by Clostridium difficile bacteria. This antibody, available in both polyclonal and monoclonal forms, is used to neutralize the toxin and prevent its harmful effects on cells. By binding to the toxin, the antibody inhibits its ability to cause cell cytotoxicity.
ACTH antibody
The ACTH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to adrenocorticotropic hormone (ACTH), a peptide hormone involved in the regulation of steroid synthesis in the adrenal glands. This antibody has been extensively studied and validated for its high specificity and affinity towards ACTH.
Keratin K27 antibody
Keratin K27 antibody was raised in Guinea Pig using synthetic peptide of human keratin K27 coupled to KLH as the immunogen.
Degré de pureté :Min. 95%STUB1 antibody
STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF
Goat anti Human Lambda Chain (Texas Red)
Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.
Degré de pureté :Min. 95%Goat anti Human IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Degré de pureté :Min. 95%ERK2 antibody
The ERK2 antibody is a highly specific monoclonal antibody that targets the extracellular signal-regulated kinase 2 (ERK2). This antibody plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. It is commonly used in research and diagnostic applications to study the activation of ERK signaling pathways.Degré de pureté :Min. 95%Chlormadinone acetate antibody
Sheep polyclonal Chlormadinone acetate antibody
Degré de pureté :Min. 95%HDAC2 antibody
The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.
PHTF1 antibody
PHTF1 antibody was raised in mouse using recombinant Putative Homeodomain Transcription Factor 1HNRPLL antibody
HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
Transferrin Receptor antibody
The Transferrin Receptor antibody is a monoclonal antibody that specifically targets the transferrin receptor, which is involved in the uptake of iron into cells. This antibody has been extensively studied in various fields of life sciences and has shown promising results. It has been used in adipose tissue research to study the role of transferrin in growth factor signaling pathways. In low-molecular-weight toxicity studies, this antibody has been found to be safe and well-tolerated.BCAT1 antibody
The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.
CHRNB3 antibody
CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen
Goat anti Chicken IgG (H + L)
Goat anti-chicken IgG (H+L) was raised in goat using chicken IgG, whole molecule as the immunogen.
Degré de pureté :Min. 95%TMEM158 antibody
TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
Degré de pureté :Min. 95%VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
RHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
SLC7A8 antibody
SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
PTGFRN antibody
The PTGFRN antibody is a highly specialized polyclonal antibody that targets the PTGFRN protein. This protein is involved in various cellular processes, including signal transduction and gene expression regulation. The PTGFRN antibody specifically recognizes and binds to the p38 mitogen-activated protein (MAP) kinase and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathways.
ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLDegré de pureté :Min. 95%PKC delta antibody
The PKC delta antibody is a powerful tool used in life sciences research. It specifically targets and detects the protein kinase C delta (PKC δ), which plays a crucial role in cell signaling pathways. This polyclonal antibody can be used to study various biological processes, including androgen and epidermal growth factor signaling, histidine phosphorylation, and cholinergic neurotransmission.
Degré de pureté :Min. 95%CXCL16 antibody
The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.
REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
LGALS3 antibody
LGALS3 antibody was raised using the N terminal of LGALS3 corresponding to a region with amino acids GASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPG
SMYD3 antibody
The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.
GJA1 antibody
The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.
Ubiquitin antibody
The Ubiquitin antibody is a highly specific monoclonal antibody that targets the ubiquitin molecule. It is widely used in life sciences research for various applications, including immunoassays and the detection of target molecules. This antibody has been shown to have a high affinity for ubiquitin and can effectively detect its presence in samples.CKS2 antibody
The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.
OXTR antibody
OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%E2F4 antibody
The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.
BHMT antibody
The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.
SAA antibody
The SAA antibody is an anti-HER2 antibody-drug that targets the epidermal growth factor receptor (EGFR) pathway. It belongs to the class of monoclonal antibodies and is designed to inhibit the growth and proliferation of cancer cells. The SAA antibody specifically binds to HER2, a protein that is overexpressed in certain types of cancer, including breast cancer. By binding to HER2, the antibody prevents the activation of downstream signaling pathways that promote cell growth and survival. This targeted approach minimizes damage to healthy cells and reduces side effects associated with traditional chemotherapy drugs. The SAA antibody has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential as a treatment for HER2-positive cancers. With its high specificity and ability to block HER2 signaling, the SAA antibody represents a promising advancement in the field of targeted therapy for cancer.Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
PIN4 antibody
PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Cathepsin S antibody
The Cathepsin S antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the activity of Cathepsin S, a proteolytic enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in studies involving mesenchymal stem cells, taxol, and other related compounds. It can be used for immobilization studies, as well as in vitro assays to measure enzyme activity. The Cathepsin S antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it an ideal tool for studying the role of Cathepsin S in various biological processes.
Tau antibody
The Tau antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets and binds to the protein Tau, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. The antibody has been extensively studied and validated for its specificity and sensitivity.Degré de pureté :Min. 95%MST4 antibody
The MST4 antibody is a chimeric protein that falls under the category of Life Sciences. It is a monoclonal antibody that specifically targets MST4, a protein involved in various cellular processes. This antibody has been extensively studied and characterized for its high specificity and affinity towards MST4.
FANCA antibody
The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.
RBP1 antibody
RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
HIF3A antibody
HIF3A antibody was raised in rabbit using the C terminal of HIF3A as the immunogen
Degré de pureté :Min. 95%p27 antibody
The p27 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets c-myc, antiphospholipid antibodies, autoantibodies, fibrinogen, superoxide, antibodies, tyrosine, ribosomal binding, alpha-synuclein, Polyclonal Antibodies, collagen, and anticoagulant. This antibody plays a crucial role in various research applications such as immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA).
