Anticorps primaires

Rabbit polyclonal IL13 antibody (biotin)

ACHE antibody was raised in Rabbit using Human ACHE as the immunogen

Rabbit polyclonal ELF1 antibody

H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV

The SIGLEC7 antibody is an inhibitory antibody that targets adeno-associated viruses. It is a polyclonal antibody that specifically binds to the SIGLEC7 receptor, which is expressed on various immune cells. This antibody has been shown to inhibit the activity of serotonin, a neurotransmitter involved in regulating mood and behavior. In addition, it can also bind to antigenic proteins and block their interaction with other molecules. The SIGLEC7 antibody has potential applications in life sciences research and the development of therapeutic antibodies for various diseases. It can be used as a tool to study the function of SIGLEC7 and its role in immune responses. Furthermore, this antibody may have clinical implications as a potential treatment for autoimmune disorders or as a targeted therapy for certain types of cancer.

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

Sheep polyclonal Lorazepam antibody

C1QA antibody was raised in Rabbit using Human C1QA as the immunogen

AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.

Affinity purified Rabbit polyclonal ENTPD5 antibody

ALKBH1 antibody was raised in Rabbit using Human ALKBH1 as the immunogen

Mouse monoclonal GORASP1 antibody

Factor VII antibody is a polyclonal antibody that targets the activated form of factor VII, a surface glycoprotein involved in the coagulation cascade. This antibody has been widely used in life sciences research to study the role of factor VII in various physiological processes. It has been shown to inhibit factor VII activity and gluconeogenesis in vitro. Additionally, this antibody has been used as a tool in multi-agent chemotherapy studies to investigate its potential therapeutic effects. Factor VII antibody can be used in various applications such as immunoassays, electrophoresis, and Western blotting to detect and quantify factor VII levels in samples. Its high specificity and sensitivity make it an essential tool for researchers studying coagulation pathways and related disorders.

GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL

CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.

The ERH antibody is a monoclonal antibody that targets the ERH protein. This protein is involved in various cellular processes, including insulin signaling and glutamate metabolism. The ERH antibody specifically recognizes the amino group of the ERH protein and can be used in various applications, such as Western blotting and immunohistochemistry.

Purified Polyclonal NCKX1 antibody

Rabbit polyclonal UGP2 antibody

The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.

The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.

Rabbit polyclonal PCSK5 antibody

Rabbit polyclonal EGF antibody (biotin)

Rabbit polyclonal PFN1 antibody (FITC)

The PP2A antibody is a highly specialized electrode used for the detection and analysis of Polyclonal Antibodies. This antibody is specifically designed to target and bind to adipocyte markers, allowing for accurate identification and characterization of these cells. The PP2A antibody has been shown to be effective in detecting acidic glycosylation patterns on adipocytes, which play a crucial role in their function and metabolism. Additionally, this antibody has been found to modulate superoxide production in adipocytes, suggesting a potential therapeutic application in oxidative stress-related disorders. Furthermore, studies have shown that the PP2A antibody can enhance e-cadherin expression in adipocytes, promoting cellular adhesion and insulin sensitivity. With its high specificity and sensitivity, the PP2A antibody is an invaluable tool for researchers in the field of Life Sciences studying interferon signaling pathways, adipose tissue biology, fatty acid metabolism, and more.

GSR antibody was raised in Rabbit using Human GSR as the immunogen

Rabbit polyclonal MAP3K1 antibody (biotin)

Rabbit polyclonal PTAFR antibody

Affinity purified Rabbit polyclonal NEGR1 antibody

The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.

Affinity purified Rabbit polyclonal ARF1 antibody

C3orf20 antibody was raised in Rabbit using Human C3orf20 as the immunogen

Rabbit polyclonal SLC11A2 antibody

The UBE1 antibody is a highly specialized antibody that targets the ubiquitin-activating enzyme 1 (UBE1). This enzyme plays a crucial role in the process of protein degradation by attaching ubiquitin molecules to target proteins. The UBE1 antibody specifically recognizes and binds to UBE1, inhibiting its activity and preventing the degradation of target proteins.

Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.

Rabbit polyclonal UQCRFS1 antibody (FITC)

Affinity purified Rabbit polyclonal DYNC1I2 antibody

Affinity purified Rabbit polyclonal Activin A Receptor type IIA antibody

Mouse monoclonal B7H4 antibody (PE)

EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to dopamine beta hydroxylase, an enzyme involved in the synthesis of norepinephrine. This antibody is commonly used in research and diagnostic assays to study the role of dopamine beta hydroxylase in various biological processes.

Rabbit polyclonal GPR83 antibody

The Smoothelin antibody is a highly specific antibody that targets smoothelin, a protein found in smooth muscle cells. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is produced using state-of-the-art techniques, ensuring high affinity and specificity. It can be used to study the role of smoothelin in various physiological and pathological processes, such as smooth muscle contraction, cardiovascular diseases, and cancer. The Smoothelin antibody is an essential tool for researchers in the field of life sciences who are interested in understanding the function of smooth muscle cells and developing potential therapeutic interventions.

JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.

The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.

The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.

GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR

The ZFP36 antibody is a polypeptide that belongs to the family of Polyclonal Antibodies. It is also available as a monoclonal antibody. This antibody is widely used in the field of Life Sciences for various research applications. The polyclonal antibodies are produced by immunizing animals with specific antigens, resulting in the production of antibodies that recognize multiple epitopes on the target protein. On the other hand, monoclonal antibodies are produced from a single clone of cells and recognize a specific epitope on the target protein. Both types of antibodies are valuable tools in scientific research for studying protein expression, localization, and function.

Rabbit polyclonal PCK1 antibody

Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.

Rabbit polyclonal INHBB antibody

Rabbit anti-chicken IgG (Alk Phos) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.

The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.

Rabbit polyclonal RGS7 antibody

FGF19 antibody is a highly specialized drug antibody that targets fibroblast growth factor 19 (FGF19). FGF19 is a growth factor that plays a crucial role in regulating the metabolism of fatty acids. This antibody has been developed for use in antiestrogen therapy, as it can effectively block the activity of FGF19 and inhibit its effects on adipose tissue.

The ICK antibody is a highly specialized antibody that targets the tyrosine kinase receptor, which plays a crucial role in growth factor signaling. This antibody is designed to specifically bind to the receptor and inhibit its activity, thereby blocking the downstream signaling pathways involved in cell growth and proliferation.

Rabbit polyclonal SPR1 antibody

HDLBP antibody was raised in Rabbit using Human HDLBP as the immunogen

Affinity purified Rabbit polyclonal TCP1 epsilon antibody

Rabbit polyclonal CHMP2A antibody (HRP)

Rabbit polyclonal Ku80 antibody (Thr714)

RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

The Cystatin B antibody is a highly specific and reliable tool for detecting and measuring Cystatin B levels in human serum samples. This polyclonal antibody has been extensively validated and shows excellent performance in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.

Rabbit polyclonal CYP2A13 antibody

The Hemoglobin antibody is a powerful tool used in various research and diagnostic applications. It specifically targets the virus surface antigen and amyloid plaque, making it an essential component in studying viral infections and neurodegenerative diseases.

KAT5 antibody was raised in Rabbit using Human KAT5 as the immunogen

The RBM5 antibody is a powerful antiviral agent that belongs to the family of antibodies. It specifically targets proteins such as anti-mesothelin and alpha-fetoprotein, which are known to play a crucial role in various diseases. The RBM5 antibody has been shown to have neutralizing effects on these proteins, preventing them from causing harm to the body.

Mouse monoclonal CD205 antibody (FITC)

IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen

Rabbit polyclonal RPS6KA2 antibody

MARVELD2 antibody was raised in Rabbit using Human MARVELD2 as the immunogen

PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Rat monoclonal Toll-like receptor 9 antibody (PE)

Rabbit polyclonal TNFSF11 antibody (biotin)

ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG

EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen

DOK5 antibody was raised in Rabbit using Human DOK5 as the immunogen

SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CXXC1 antibody was raised in Rabbit using Human CXXC1 as the immunogen

SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

Rabbit polyclonal ZMY11 antibody

The Caspase 6 antibody is a highly specialized affinity ligand that belongs to the class of polyclonal antibodies. It is specifically designed for the isolation and detection of retinal caspase 6, an important enzyme involved in programmed cell death. This antibody is commonly used in life sciences research, particularly in studies related to apoptosis and cell death pathways. It can be used as a powerful tool for investigating caspase 6 inhibitors, nuclear intermediates, and potential therapeutic medicines. The Caspase 6 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable choice for researchers working with caspase 6-related studies. Whether you are conducting experiments or developing diagnostic tests, this antibody will provide accurate and reproducible results. With its high-quality formulation and solubilized format, it offers ease of use and convenience in various applications. Trust the Caspase 6 antibody to enhance your research capabilities and advance your scientific discoveries.

Rabbit polyclonal SYT17 antibody

CALR3 antibody was raised in Rabbit using Human CALR3 as the immunogen

CLSTN1 antibody was raised in Rabbit using Human CLSTN1 as the immunogen

Mouse monoclonal PDE4B antibody

The TRPC3 antibody is a powerful tool for researchers in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which is known to play a crucial role in various cellular processes. This antibody can be used to detect activated epidermal growth factor and has been extensively studied for its ability to inhibit protease activity.

Affinity purified Rabbit polyclonal Unc182 antibody

KPNA2 antibody was raised in Rabbit using Human KPNA2 as the immunogen

AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.

The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.

Mouse monoclonal Granulocytes antibody (FITC)

ANPEP antibody was raised in Rabbit using Human ANPEP as the immunogen

Affinity purified Rabbit polyclonal C11orf2 antibody

Affinity purified Rabbit polyclonal Fibulin 2 antibody

SCYL1 antibody was raised in rabbit using the C terminal of SCYL1 as the immunogen

Affinity purified Rabbit polyclonal Protease Inhibitor 15 antibody

The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.

SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

CKB antibody was raised in Rabbit using Human CKB as the immunogen

Affinity purified Rabbit polyclonal HPS6 antibody

NAP1L1 antibody was raised in Rabbit using Human NAP1L1 as the immunogen

Rat monoclonal CD44 antibody (allophycocyanin)

The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.

Rabbit polyclonal TRAM2 antibody

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE

Affinity purified Rabbit polyclonal Fibrinogen gamma antibody

The FAM84B antibody is a monoclonal antibody that specifically targets the FAM84B protein. This protein is involved in various biological processes, including collagen synthesis and adiponectin production. By targeting this molecule, the FAM84B antibody can modulate these processes and potentially have therapeutic effects.

GMDS antibody was raised in Rabbit using Human GMDS as the immunogen

NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

The MMP8 antibody is a polyclonal antibody that specifically targets matrix metalloproteinase 8 (MMP8). It is commonly used in research and diagnostic applications to detect and quantify the presence of MMP8 in various samples.

Affinity purified Rabbit polyclonal GRASP1 antibody

The MTA1 antibody is a highly specific monoclonal antibody that targets the MTA1 protein. It is commonly used in life sciences research to study various cellular processes and pathways. The MTA1 protein plays a crucial role in gene regulation and has been implicated in cancer progression and metastasis.

Mouse monoclonal Cytokeratin 5 + 8 antibody

Sheep polyclonal Urochloralic Acid antibody

Affinity purified Rabbit polyclonal DPRP1 antibody

The p21 antibody is a chemokine that is widely used in immunoassays. It belongs to the class of polyclonal antibodies and is commonly used as a medicament in various applications. This antibody has been shown to have reactive and neutralizing properties, making it highly effective in targeting specific antigens. It is often used in research involving mesenchymal stem cells and cardiomyocytes, where it plays a crucial role in studying their functions and interactions. The p21 antibody is also used in the detection and measurement of various substances, such as steroids and recombinant antigens, through antigen-antibody reactions. In the field of Life Sciences, this antibody is an essential tool for researchers conducting experiments involving polymerase chain reactions, acetylcholine signaling, and the study of autoantibodies. With its versatility and reliability, the p21 antibody is an invaluable asset for scientists seeking to advance their understanding of cellular processes and develop innovative medical solutions.

GSK3beta antibody was raised in mouse using recombinant human GSk3 beta (341-420aa) purified from E. coli as the immunogen.

Affinity purified Rabbit polyclonal ULK2 antibody

Affinity purified Rabbit polyclonal p21 ARC antibody

CD38 antibody (PE) was raised in rat using CD38 as the immunogen.

CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.

Affinity purified Rabbit polyclonal BBS7 antibody

RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

The TYK2 antibody is a powerful tool used in the field of Life Sciences. It is a multidrug that targets the nuclear chemokine receptors and acts on actin filaments. This antibody has been extensively studied and has shown efficacy in various research areas.

CPA5 antibody was raised in Rabbit using Human CPA5 as the immunogen

CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

Mouse monoclonal CD11b antibody (FITC)

CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.

TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.

CD45RC antibody (biotin) was raised in rat using an exon C-depentent epitope of the CD45 glycoprotein as the immunogen.

Rabbit polyclonal SQLE antibody

EGLN2 antibody was raised in Rabbit using Human EGLN2 as the immunogen

ABHD14A antibody was raised in Rabbit using Human ABHD14A as the immunogen

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

Rabbit polyclonal NFKB p105 antibody

Rabbit Polyclonal Synaptotagmin II antibody (Thr202)

CYB5R3 antibody was raised in Rabbit using Human CYB5R3 as the immunogen

CD4 antibody (PE) was raised in mouse using feline CD4 as the immunogen.

ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal PDHA1 antibody

CST7 antibody was raised in Rabbit using Human CST7 as the immunogen

Rabbit polyclonal 14-3-3 alpha/beta antibody (biotin)

Affinity purified Rabbit polyclonal HLADMB antibody

Rabbit polyclonal ICK antibody (Tyr159)

Rabbit polyclonal P2RY13 antibody

CD117 antibody (PE) was raised in rat using murine CD117/c-Kit as the immunogen.

CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.

Rabbit polyclonal COX5A antibody (FITC)

Rabbit polyclonal CDK1 antibody (Tyr15)

GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen

Rabbit polyclonal STAT1 antibody (Ser727)

Rabbit polyclonal PRKCI antibody

The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.

MTNR1A antibody was raised in rabbit using the C terminal of MTNR1A as the immunogen

STK17A antibody was raised in rabbit using the C terminal of STK17A as the immunogen

Affinity purified Rabbit polyclonal PSMF1 antibody

The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.

EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.

Rabbit polyclonal PP2A antibody (FITC)

The PARK7 antibody is a monoclonal antibody that targets the PARK7 protein, also known as DJ-1. This protein is involved in various cellular processes, including hepatocyte growth, fibronectin binding, and lipoprotein lipase activity. The PARK7 antibody has been shown to inhibit the growth of MCF-7 cells, a breast cancer cell line. Additionally, it has cytotoxic effects on tumor cells and can enhance the effectiveness of retinoid-based therapies. The PARK7 antibody is also useful for detecting the presence of creatine kinase and multidrug resistance-associated protein 1 (MRP1). It is available as both polyclonal and monoclonal antibodies.

IDH2 antibody was raised in Rabbit using Human IDH2 as the immunogen

The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.

MRO antibody was raised in rabbit using the C terminal of MRO as the immunogen

Affinity purified Rabbit polyclonal ARHGAP4 antibody

Rabbit polyclonal Src antibody (Tyr216)

Rabbit polyclonal COX5B antibody (biotin)

Rabbit polyclonal SSSCA1 antibody

Rabbit polyclonal Casein kinase 2 antibody (FITC)

Purified Rabbit polyclonal NDUFA4 antibody

MYBL2 antibody was raised in Rabbit using Human MYBL2 as the immunogen

GUCA1A antibody was raised in Rabbit using Human GUCA1A as the immunogen

TH antibody is a monoclonal antibody that targets the growth factor known as epidermal growth factor (EGF). It specifically binds to EGF and inhibits its activity, making it an effective tool for research in the field of Life Sciences. This antibody has been used in various studies to investigate the role of EGF in different biological processes. Additionally, TH antibody has shown neuroprotective properties by reducing dopamine levels in the brain. It can be used in experiments involving electrode recordings or binding protein analysis. Whether you're studying cell signaling pathways or developing new therapeutic approaches, TH antibody is a valuable tool for your research.

Rat monoclonal CD5 antibody (allophycocyanin)

CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.

hCG antibody was raised in rabbit using hCG as the immunogen.

CPSF1 antibody was raised in Rabbit using Human CPSF1 as the immunogen

PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Rabbit polyclonal UBE2H antibody

The Annexin A1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various cellular processes, including hepatocyte growth, epidermal growth factor signaling, and TGF-beta regulation. This antibody has been shown to neutralize the effects of growth factors such as transferrin and promote cellular homeostasis. With its high specificity and affinity for Annexin A1, this antibody can effectively bind to the protein and modulate its activity.