Anticorps primaires

<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>

<p>PUMA antibody was raised in rabbit using 17 residue sequence 29-55 [EQHLESPVPSAPGALAG] found in the exon-3-encoded region in the human PUMA-Alpha and PUMA-Beta forms of the protein as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rabbit polyclonal PP1 alpha antibody</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>Rabbit Polyclonal MARK1 antibody (Thr215)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits bactericidal activity against mycobacterium strains. It achieves this by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, it has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>LSM4 antibody was raised in Rabbit using Human LSM4 as the immunogen</p>

<p>CNOT2 antibody was raised in mouse using recombinant Human Ccr4-Not Transcription Complex, Subunit 2 (Cnot2)</p>

<p>DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI</p>

<p>The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.</p>

<p>NFYA antibody was raised in Rabbit using Human NFYA as the immunogen</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Rabbit Polyclonal IKK beta antibody (Tyr199)</p>

<p>POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL</p>

<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Rabbit Polyclonal Abl1 antibody (Tyr204)</p>

<p>The ITCH antibody is a powerful tool in the field of immunology and cancer research. It is a polyclonal antibody that specifically targets the ITCH protein, which plays a crucial role in various cellular processes. The ITCH antibody has been extensively studied for its ability to inhibit the activity of carbonyl reductase, an enzyme involved in drug metabolism.</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>Rabbit polyclonal RRAS antibody</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>

<p>Purified Rabbit polyclonal p53 antibody (Ser392)</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

<p>Rabbit polyclonal EPHB6 antibody</p>

<p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>

<p>Rabbit Polyclonal PKR antibody (Thr446)</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>MAST1 antibody was raised in Rabbit using Human MAST1 as the immunogen</p>

<p>Purified Polyclonal TAF6L antibody</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>The HDAC2 Antibody is a highly effective tool for studying the role of histone deacetylase 2 (HDAC2) in various cellular processes. This antibody specifically targets HDAC2, a key enzyme involved in the regulation of gene expression through the modification of histone proteins. By binding to HDAC2, this antibody allows for the detection and quantification of HDAC2 levels in cells and tissues.</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>Rabbit anti-rat IgG (H+L) (FITC) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal CARD10 antibody</p>

<p>Rabbit polyclonal OLFML2B antibody</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS</p>

<p>Rabbit polyclonal KAD5 antibody</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>The CYP2J2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that specifically targets the CYP2J2 enzyme, which plays a crucial role in the metabolism of arachidonic acid. This antibody has high bioavailability and can effectively neutralize the activity of CYP2J2.</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGG</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>IgG2a Negative Control Monoclonal Antibody</p>

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>Purified Polyclonal PSMC6 antibody</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>Mouse monoclonal UBOX5 antibody</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>

<p>Rabbit polyclonal MRPL4 antibody</p>

<p>Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS</p>

<p>Purified Polyclonal RAB35 antibody</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>Rabbit polyclonal APBB1IP antibody</p>

<p>The SURVIVIN antibody is a powerful tool in the field of Life Sciences. It is an essential biomolecule that plays a crucial role in cell survival and proliferation. This antibody specifically targets survivin, an anti-apoptotic protein that is highly expressed in various tumor cells.</p>

<p>The IkB alpha antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activated form of IkB alpha, a protein that plays a crucial role in cellular signaling pathways. By binding to IkB alpha, this antibody prevents its interaction with 14-3-3 isoforms, thereby inhibiting downstream signaling events.</p>

<p>MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD</p>

<p>C14ORF148 antibody was raised using the middle region of C14Orf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG</p>

<p>Mouse monoclonal FZE3 antibody</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Rabbit polyclonal PRDM12 antibody</p>

<p>Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF</p>

<p>AHCTF1 antibody was raised in mouse using recombinant Human At Hook Containing Transcription Factor 1 (Ahctf1)</p>

<p>XAB2 antibody was raised in rabbit using the C terminal of XAB2 as the immunogen</p>

<p>Rabbit polyclonal OR8J3 antibody</p>

<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids  MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD</p>

<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>

<p>TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY</p>

<p>LDLRAD1 antibody was raised in Rabbit using Human LDLRAD1 as the immunogen</p>

<p>VEGFB antibody was raised in rabbit using the C terminal of VEGFB as the immunogen</p>

<p>Pnpla6 antibody was raised in rabbit using the C terminal of Pnpla6 as the immunogen</p>

<p>The FGFR3 antibody is a histidine-rich interferon family kinase inhibitor that is widely used in the Life Sciences field. It possesses strong inhibitory properties, particularly against diacylglycerol, making it an effective tool for studying various cellular processes. This monoclonal antibody specifically targets and binds to the glycoprotein FGFR3, blocking its activity and preventing the activation of downstream signaling pathways. By inhibiting FGFR3, this antibody can interfere with epidermal growth factor-mediated cell proliferation and survival. Additionally, it has cytotoxic effects on cancer cells that overexpress FGFR3, making it a potential therapeutic option for certain types of cancers. The FGFR3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with versatile tools for their experiments.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Rabbit polyclonal Spermidine synthase antibody (HRP)</p>

<p>Rabbit Polyclonal Fyn antibody (Tyr530)</p>

<p>The TWEAK antibody is a growth factor that is naturally present in blood plasma. It is an essential component of the immune system and plays a crucial role in various biological processes. The TWEAK antibody can be used as a therapeutic agent to target specific proteins or cells in the body.</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>Purified Rabbit polyclonal MADS91 antibody</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Rabbit polyclonal LAMB1 antibody</p>

<p>CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS</p>

<p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

<p>Purified Polyclonal AKAP13 antibody</p>

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>NAT8 antibody was raised in Rabbit using Human NAT8 as the immunogen</p>

<p>LIMA1 antibody was raised in Rabbit using Human LIMA1 as the immunogen</p>

<p>Mouse monoclonal anti human GARS antibody</p>

<p>The TRBC1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of antibodies and is specifically designed to target and bind to TRBC1, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>Rabbit polyclonal RAPGEFL1 antibody</p>

<p>Rabbit polyclonal BLCAP antibody</p>

<p>Rabbit polyclonal TPD54 antibody</p>

<p>Purified Polyclonal Alpha actin 3 antibody</p>

<p>The Fractin antibody is a highly specialized monoclonal antibody that has neutralizing properties against androgen. It acts as an inhibitor of cytotoxic growth factors by binding to specific proteins, such as glycoproteins and chemokines. This antibody is commonly used in research settings to study the effects of these growth factors on various cell types.</p>

<p>ADRA1B antibody was raised in rabbit using the C terminal of ADRA1B as the immunogen</p>

<p>DHRS2 antibody was raised in Rabbit using Human DHRS2 as the immunogen</p>

<p>Rabbit Polyclonal eIF2 alpha antibody (Ser49)</p>

<p>Rabbit Polyclonal PPP1R2 antibody (Ser120+Ser121)</p>

<p>Rabbit polyclonal KCNC4 antibody</p>

<p>Calsequestrin antibody was raised in mouse using purified rabbit skeletal muscle sarcoplasmic reticulum as the immunogen.</p>