Anticorps primaires

CARD6 antibody was raised in Rabbit using Human CARD6 as the immunogen

Rabbit polyclonal RPS13 antibody (biotin)

Rabbit polyclonal ZHX1 antibody

ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen

IFN gamma antibody is a growth factor that plays a crucial role in the immune response. This antibody specifically targets and neutralizes interferon-gamma, a key cytokine involved in immune regulation. The IFN gamma antibody is produced using advanced techniques such as electrophoresis and lyophilization, ensuring its high purity and stability. It can be used in various research applications in the field of Life Sciences, including immunological studies and cell culture experiments. This monoclonal antibody has been extensively tested for its specificity and potency, making it a reliable tool for researchers studying the role of interferon-gamma in different biological processes. With its high affinity and selectivity, the IFN gamma antibody provides valuable insights into the complex mechanisms of immune activation and regulation.

Mouse monoclonal EFNA2 antibody

Rabbit polyclonal TUBB3 antibody (FITC)

Rabbit polyclonal RAI1 antibody

BCAR1 antibody was raised in Rabbit using Human BCAR1 as the immunogen

Rabbit polyclonal BLOC1 antibody (FITC)

SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP

The IL10 antibody is a powerful cytotoxic agent used in Life Sciences research. It is an antibody that specifically targets and binds to interleukin-10 (IL-10), a cytokine involved in immune regulation. This antibody can be conjugated with cytotoxic agents to create a cytotoxic conjugate, which can selectively kill cells expressing IL-10 receptors.

beta 2 Microglobulin antibody was raised using the N terminal of B2M corresponding to a region with amino acids MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

YIPF4 antibody was raised in rabbit using the N terminal of YIPF4 as the immunogen

Affinity purified Rabbit polyclonal DNAJB6 antibody

The BAT antibody is a highly specific monoclonal antibody that is used in various assays to detect and measure the levels of interferon (IFN) in biological samples. This antibody has been extensively validated and proven to be highly sensitive and specific for IFN detection. It has been shown to neutralize the activity of IFN, making it an essential tool for studying the role of IFN in various biological processes.

Rabbit polyclonal RUSC1 antibody

The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.

The SQSTM1 antibody is a highly specialized monoclonal antibody that is used for immobilization and detection of SQSTM1 protein. It specifically targets and binds to the SQSTM1 protein, allowing for its easy detection and analysis in various biological samples. This antibody is widely used in research laboratories and diagnostic settings to study the role of SQSTM1 in different cellular processes.

EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW

The Ovalbumin antibody is a polyclonal antibody that specifically targets the ovalbumin protein. Ovalbumin is a basic protein found in egg whites and is commonly used in life sciences research as a model antigen. This antibody has been developed to bind to the CD3 receptor, which is expressed on T cells, making it an ideal tool for studying T cell activation and function. The Ovalbumin antibody is reactive and can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used as a diagnostic reagent for detecting ovalbumin or related proteins in human serum samples. Additionally, this antibody has neutralizing properties and can inhibit the activity of TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. With its high specificity and affinity, the Ovalbumin antibody is an essential tool for researchers working in the field of immunology and molecular biology.

Rabbit polyclonal QARS antibody

The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.

The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.

ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen

Mouse monoclonal CHEK2 antibody

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE

C1orf50 antibody was raised in Rabbit using Human C1orf50 as the immunogen

Rabbit polyclonal Alkylphenols antibody

PDLIM1 antibody was raised in rabbit using the middle region of PDLIM1 as the immunogen

The IFN alpha antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is known for its antiviral properties. This antibody specifically targets CD20 antibodies, making it an effective tool for research and therapeutic applications.

Rabbit polyclonal VASH1 antibody

Rabbit polyclonal GJC3 antibody

Rabbit Polyclonal GSK3 beta antibody (Tyr216)

Rabbit polyclonal EXTL3 antibody (biotin)

CAPRIN2 antibody was raised in Rabbit using Human CAPRIN2 as the immunogen

Proteasome 20S antibody was raised in rabbit using a Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2 as the immunogen.

The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.

FNDC3B antibody was raised using the N terminal of FNDC3B corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP

KTN1 antibody was raised in Rabbit using Human KTN1 as the immunogen