Anticorps primaires

MBD5 antibody was raised in Rabbit using Human MBD5 as the immunogen

Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.

Affinity purified Rabbit polyclonal ZC3H8 antibody

Rabbit polyclonal LAMC3 antibody

Affinity purified Rabbit polyclonal PANK1 antibody

Affinity purified Rabbit polyclonal NNT1 antibody

The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE

TSHR antibody was raised using the C terminal of TSHR corresponding to a region with amino acids KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS

CD4 antibody was raised in mouse using CD4+ transfectant/CEM as the immunogen.

Affinity purified Rabbit polyclonal CYFIP2 antibody

The GST antibody is a cholinergic monoclonal antibody used in Life Sciences research. It specifically targets and binds to the glutathione S-transferase (GST) protein, which is involved in various cellular processes. This antibody is commonly used in studies related to alpha-fetoprotein, cryptosporidium, adeno-associated virus, activated epidermal growth factor, β-catenin, steroid acetyltransferase, and electrode research. The GST antibody has been extensively tested and validated for its specificity and sensitivity in detecting GST protein in various samples, including human serum. Researchers rely on this antibody to accurately analyze the expression and localization of GST protein in their experiments. Its high-quality performance makes it an essential tool for studying the functions and interactions of GST in different biological systems.

Rabbit polyclonal PSMB5 antibody

Rabbit polyclonal STK33 antibody

Rabbit polyclonal Beta Enolase antibody (HRP)

BSA antibody was raised in mouse using BSA as the immunogen.

Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.

Sheep polyclonal Urochloralic Acid antibody

GPR137B antibody was raised in Rabbit using Human GPR137B as the immunogen

Affinity purified Rabbit polyclonal CSDE1 antibody

The Tyrosine Hydroxylase antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and detect tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter essential for brain function. This antibody is commonly used in immunoassays to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Rabbit polyclonal NFKB p105 antibody

Rat monoclonal CD105 antibody (biotin)

Mouse monoclonal CD3 antibody (PE)

Affinity purified Rabbit polyclonal ATP synthase delta antibody

Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.

HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen

Rat monoclonal CD86 antibody (PE)

RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITA

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infection due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

GNB2 antibody was raised in Rabbit using Human GNB2 as the immunogen

Rabbit polyclonal T3JAM antibody

KLRG1 antibody (biotin) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.

Affinity purified Rabbit polyclonal ST3GAL2 antibody

BMX antibody was raised in Mouse using a purified recombinant fragment of human BMX expressed in E. coli as the immunogen.

Affinity purified Rabbit polyclonal GLYATL1 antibody

POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen

PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS

Affinity purified Rabbit polyclonal SNTB2 antibody

The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.

RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

CES3 antibody was raised in rabbit using the C terminal of CES3 as the immunogen

Chicken polyclonal MTBE antibody

Affinity purified Rabbit polyclonal Copine 3 antibody