Anticorps primaires

SLC22A18 antibody was raised using the middle region of SLC22A18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK

Affinity purified Rabbit polyclonal Prohibitin 2 antibody

Rat monoclonal CD105 antibody (biotin)

CD23 antibody was raised in mouse using human peripheral myeloma cells as the immunogen.

Keratin K1 antibody was raised in Guinea Pig using synthetic peptide of human keratin K1 coupled to KLH as the immunogen.

ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Purified Rabbit polyclonal OR5AS1 antibody

GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

The SLAMF7 antibody is a highly specialized biomolecule that acts as a growth factor and protein kinase. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists in various fields. This monoclonal antibody specifically targets the interleukin-15 receptor, which plays a crucial role in immune response regulation.

CARM1 antibody was raised in Rabbit using Human CARM1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.

Rabbit polyclonal COMMD4 antibody (FITC)

The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.

Rabbit polyclonal BIK antibody (Thr33)

Sheep polyclonal Lorazepam antibody

Affinity purified Rabbit polyclonal Flightless I antibody

Affinity purified Rabbit polyclonal ARF1 antibody

HMG20A antibody was raised in Rabbit using Human HMG20A as the immunogen

Mesothelin antibody is a polyclonal antibody that specifically targets the mesothelin antigen. It is commonly used in Life Sciences research to study the role of mesothelin in various biological processes. Mesothelin is an epidermal growth factor (EGF)-like protein that is expressed on the surface of certain cells, including mesothelial cells and some cancer cells. The antibody binds to mesothelin and can be used for neutralizing or detecting its presence in samples. Additionally, this antibody has been shown to have cross-reactivity with other antigens such as vitronectin and glucagon. Researchers often use it alongside other antibodies, such as cetuximab, to investigate the interactions between these proteins and their potential therapeutic applications.

The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

Sheep polyclonal 17b Estradiol 6 antibody

Goat anti-monkey IgG (FITC) was raised in goat using monkey IgG as the immunogen.

Rabbit polyclonal WARS2 antibody

Rabbit polyclonal VN1R4 antibody

Rabbit polyclonal GOLM1 antibody (FITC)

DMC1 antibody was raised in Rabbit using Human DMC1 as the immunogen

C1S antibody was raised in Rabbit using Human C1S as the immunogen

KLHL3 antibody was raised in Rabbit using Human KLHL3 as the immunogen

The IFN beta antibody is a highly specialized product in the field of Life Sciences. It is designed to neutralize the activity of interferon beta, which is a growth factor involved in various cellular processes. This antibody acts as an inhibitor of protein kinase and can be used for research purposes in laboratories. The IFN beta antibody comes in both monoclonal and polyclonal forms, providing researchers with options depending on their specific needs. Additionally, this antibody has been shown to have low density and low-molecular-weight characteristics, making it ideal for certain applications. With its ability to target interferon beta, the IFN beta antibody opens up new possibilities for studying and understanding this important signaling molecule in biological systems.

Scg2 antibody was raised in rabbit using the middle region of Scg2 as the immunogen

Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Additionally, this drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

TNFRSF10B antibody was raised in rabbit using the N terminal of TNFRSF10B as the immunogen

The CacyBP antibody is a powerful tool in the field of Life Sciences. It is an anti-mesothelin antibody that has been extensively studied for its potential therapeutic applications. Mesothelin is a cell surface glycoprotein that is highly expressed in various cancers, making it an attractive target for cancer therapy.

Rabbit polyclonal 14-3-3 alpha/beta antibody (biotin)

IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL

The CtBP2 antibody is a highly specialized antibody that targets the anti-ICOS antibodies. It specifically binds to serum albumin protein and agonist proteins, effectively neutralizing their activity. This antibody has been extensively tested in various laboratory settings, including liver microsomes and drug antibody assays. It has shown potent chemokine-neutralizing properties, making it an essential tool for researchers in the life sciences field. The CtBP2 antibody is available in both polyclonal and monoclonal forms, providing flexibility for different experimental setups. Its activation potential and ability to target autoantibodies and growth factors make it a valuable asset in research studies.

SURF1 antibody was raised in rabbit using the N terminal of SURF1 as the immunogen

The GABAB Receptor antibody is a protein-based product that has chromatographic characteristics. It is a neutralizing antibody that targets the angptl3 protein, which is involved in various biological processes such as collagen synthesis and growth factor regulation. This monoclonal antibody specifically binds to the GABAB receptor, an important component of the central nervous system. By targeting this receptor, the antibody can modulate neurotransmission and potentially have therapeutic effects in neurological disorders. The GABAB Receptor antibody is activated upon binding to its target and can induce cytotoxic effects on cells expressing the receptor. Additionally, it may interact with other binding proteins such as epidermal growth factor and hepatocyte growth factor, further expanding its potential applications in research and medicine.

DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

GJA3 antibody was raised in Rabbit using Human GJA3 as the immunogen