Anticorps primaires

ATXN10 antibody was raised in Rabbit using Human ATXN10 as the immunogen

GPR137B antibody was raised in Rabbit using Human GPR137B as the immunogen

Rabbit polyclonal STOML3 antibody

This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.

The CD122 antibody is a highly effective tool used in Life Sciences research. This antibody specifically targets and binds to CD122 receptors, which are found on various cell types including immune cells, endothelial cells, and collagen-producing cells. By binding to CD122 receptors, this antibody modulates the signaling pathways involved in cell growth, differentiation, and survival.

The CEA antibody is a monoclonal antibody that specifically targets e-cadherin, a glycoprotein involved in cell adhesion. This antibody is designed to recognize and bind to e-cadherin, inhibiting its activity and preventing cell-cell interactions. The CEA antibody is commonly used in life sciences research and biochemical studies to investigate the role of e-cadherin in various cellular processes.

Affinity purified Rabbit polyclonal Calpain 5 antibody

Rat monoclonal CD86 antibody (PE)

The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal Casein kinase 2 antibody (HRP)

MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen

RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen

Purified Rabbit polyclonal HLAH antibody

RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen

Affinity purified Rabbit polyclonal PODXL2 antibody

Rabbit polyclonal AP2S1 antibody (HRP)

The SSR3 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear receptor GLP-1 and has been widely used in various assays and experiments. The SSR3 antibody is highly specific and exhibits high affinity for its target, making it an ideal tool for studying the functions of GLP-1. This antibody has been successfully used in experiments involving electrode-based techniques, such as patch-clamp recordings, as well as in immunoassays to detect GLP-1 levels in human serum samples. Additionally, the SSR3 antibody has shown efficacy in cytotoxicity assays and has been used to study the effects of GLP-1 on cell growth and survival. Its versatility and reliability make it a valuable tool for researchers working in the field of Life Sciences.

The TBLR1 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody specifically targets caspase-9, an enzyme involved in programmed cell death.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Rabbit polyclonal OGFOD2 antibody

Purified Polyclonal THRB antibody

The Influenza A antibody is a highly effective monoclonal antibody that targets the growth factor of the influenza virus. This antibody specifically binds to extracellular proteins of the virus, preventing its attachment and entry into host cells. By neutralizing the virus, it helps to inhibit viral replication and spread within the body.

TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.

GALE antibody was raised in Rabbit using Human GALE as the immunogen

Rabbit polyclonal FOXD4L1 antibody

Affinity purified Rabbit polyclonal CaMK1D antibody

The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.

Rabbit polyclonal RPL6 antibody

Rat monoclonal CD43 antibody (biotin)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.

XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Mouse monoclonal MGRN1 antibody

Rabbit anti human IgG (Fc) (Agarose Conjugated) was raised in rabbit using human IgG F(c) fragment as the immunogen.

The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.

MRO antibody was raised in rabbit using the C terminal of MRO as the immunogen

The ALPK1 antibody is a highly specific monoclonal antibody that targets the ALPK1 protein. This protein plays a crucial role in various cellular processes, including oncostatin signaling and β-catenin activation. The ALPK1 antibody has been extensively tested and validated for its specificity, ensuring accurate and reliable results in experiments.

Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.

p16 antibody was raised in mouse using recombinant p16 as the immunogen.

Rabbit polyclonal GABRB2 antibody

FAM3C antibody was raised in Rabbit using Human FAM3C as the immunogen

Affinity purified Rabbit polyclonal PEX13 antibody

The SERPINB13 antibody is a highly specialized colloidal antibody that belongs to the class of neurotrophic monoclonal antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and binds to SERPINB13, a protein involved in regulating ferritin, phosphatase, glucagon, and growth factor levels. The SERPINB13 antibody has both acidic and neutralizing properties, making it suitable for a range of research purposes. Its high specificity and affinity ensure accurate detection and quantification of SERPINB13 in various biological samples. With its exceptional performance and reliability, this monoclonal antibody is an essential tool for scientists working in diverse research areas.

Purified Polyclonal LSM2 antibody

HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN