Anticorps primaires

Rabbit polyclonal CHMP2A antibody (FITC)

CX3CL1 antibody was raised in Rabbit using Human CX3CL1 as the immunogen

The BHMT antibody is a monoclonal antibody that is reactive against amyloid plaque. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets β-catenin, which is an important protein involved in cellular signaling pathways. It has been shown to be activated in various diseases, including cancer. The BHMT antibody can also be used to detect and measure levels of glial fibrillary acidic protein (GFAP), which is a marker for astrocytes. Additionally, this antibody has been used in studies investigating the role of dopamine and other neurotransmitters in neurological disorders. It can be utilized as a tool for inhibiting protein kinase activity and studying its effects on cellular processes. The BHMT antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. It can be purchased in colloidal form for ease of use and accurate results.

The Troponin T antibody is an immunosuppressant that belongs to the group of polyclonal antibodies. It specifically targets calmodulin, a protein involved in muscle contraction and relaxation. This antibody is buffered and has neutralizing properties, making it highly effective in inhibiting the activity of calmodulin. In addition to its immunosuppressive effects, the Troponin T antibody has been shown to promote the growth of factors that regulate cell proliferation and differentiation. It also exhibits diuretic properties by enhancing the excretion of fluids from the body. This antibody is widely used in life sciences research, particularly in studies involving interleukin-6 and other cytokines. The Troponin T antibody is available as a monoclonal antibody, which ensures high specificity and affinity for its target antigen. Its versatility extends beyond research applications, as it can also be used for diagnostic purposes, such as detecting influenza hemagglutinin or monitoring signaling pathways involving PI3-kinase

Rabbit polyclonal GPR83 antibody

DOK2 antibody was raised in Rabbit using Human DOK2 as the immunogen

Rabbit polyclonal RNF10 antibody

ANXA10 antibody was raised in Rabbit using Human ANXA10 as the immunogen

The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to dopamine beta hydroxylase, an enzyme involved in the synthesis of norepinephrine. This antibody is commonly used in research and diagnostic assays to study the role of dopamine beta hydroxylase in various biological processes.

IL18 antibody is a monoclonal antibody that acts as a medicament to target specific proteins in the body. It has cytotoxic properties, meaning it can destroy targeted cells or inhibit their growth. IL18 antibody specifically targets plasminogen activator receptor and alpha-fetoprotein, which are proteins involved in various biological processes. By binding to these proteins, IL18 antibody neutralizes their function and prevents them from carrying out their normal activities.

GCK antibody was raised in rabbit using the N terminal of GCK as the immunogen

RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA

Affinity purified Rabbit polyclonal Lefty A antibody

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.

The RPS3 antibody is a monoclonal antibody that specifically targets the tyrosine kinase receptor. It has been shown to have cytotoxic effects when used in combination with doxorubicin, a commonly used chemotherapy drug. The RPS3 antibody works by binding to the receptor and activating downstream signaling pathways that lead to cell death. Additionally, this antibody has been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. Furthermore, the RPS3 antibody has been shown to neutralize extracellular histones, which are released during cell death and can cause tissue damage. This highly specific and potent antibody is an essential tool for researchers in the life sciences field studying growth factors and tyrosine kinase receptors. Whether you're conducting experiments or developing new therapeutics, the RPS3 antibody is a valuable asset for your research endeavors.

ACTN2 antibody was raised in Rabbit using Human ACTN2 as the immunogen

PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, also known as Rifapentine, is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, Rifapentine inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Factor XII antibody was raised in goat using human Factor XII purified from plasma as the immunogen.

Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.

Affinity purified Rabbit polyclonal TCP1 epsilon antibody

The BAD antibody is a polyclonal antibody that specifically targets the BAD protein. BAD (Bcl-2 associated death promoter) is a key regulator of apoptosis, or programmed cell death. This antibody is widely used in life sciences research to study the role of BAD in various cellular processes.

Mouse monoclonal MTFMT antibody

Mouse monoclonal SLFNL1 antibody

Affinity purified Rabbit polyclonal Munc 13 4 antibody

Affinity purified Rabbit polyclonal IL17 Receptor D antibody

The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.

RPS9 antibody was raised in rabbit using the C terminal of RPS9 as the immunogen

Mouse monoclonal Episialin antibody

Rabbit polyclonal RGS7 antibody

FGF19 antibody is a highly specialized drug antibody that targets fibroblast growth factor 19 (FGF19). FGF19 is a growth factor that plays a crucial role in regulating the metabolism of fatty acids. This antibody has been developed for use in antiestrogen therapy, as it can effectively block the activity of FGF19 and inhibit its effects on adipose tissue.

Rabbit polyclonal CYP2A13 antibody

GP1BA antibody was raised in Rabbit using Human GP1BA as the immunogen

Rabbit polyclonal CHMP2A antibody (HRP)

NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen

PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

CCDC25 antibody was raised in Rabbit using Human CCDC25 as the immunogen

Mouse monoclonal ARNTL antibody

ANGPTL3 antibody was raised in rabbit using the N terminal of ANGPTL3 as the immunogen

TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.

CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.

The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.

The PMVK antibody is a highly specialized antibody that plays a crucial role in the immune response. It is activated by interferon-gamma (IFN-gamma) and exhibits cytotoxic activity against target cells. This antibody specifically targets tyrosine residues on growth factors, leading to their neutralization and inhibition of cell proliferation. Additionally, the PMVK antibody has been shown to bind to annexin proteins, which are involved in apoptotic processes. This monoclonal antibody is produced using cutting-edge technology and is highly specific for its target antigen. It has been widely used in life sciences research, including studies on adenine metabolism and the development of antiviral therapies.