Anticorps primaires

CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.

CDC6 antibody was raised in Rabbit using Human CDC6 as the immunogen

MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

BVES antibody was raised in Rabbit using Human BVES as the immunogen

The Myc Tag antibody is a highly reactive antibody that is commonly used in Life Sciences research. It specifically targets the Myc epitope, which is a small protein tag often fused to target proteins for detection and purification purposes. This antibody has been extensively validated and shown to have high affinity and specificity for the Myc tag.

Prohibitin antibody was raised using the C terminal of PHB corresponding to a region with amino acids AEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLS

Affinity purified Rabbit polyclonal AKAP10 antibody

Affinity purified Rabbit polyclonal HMBOX1 antibody

GBP1 antibody was raised in Rabbit using Human GBP1 as the immunogen

The PCBP2 antibody is a polyclonal antibody that specifically targets the PCBP2 protein. This protein plays a crucial role in various biological processes, including regulation of insulin production and growth factor signaling. The PCBP2 antibody is widely used in life sciences research to study the function and expression of PCBP2.

Affinity purified Rabbit polyclonal Proteasome 20S alpha 6 antibody

Mouse monoclonal PRMT2 antibody

Enterovirus antibody is a biomolecule that specifically targets the glycoprotein of enteroviruses. It is a monoclonal antibody that has been shown to have neutralizing properties against enteroviruses, preventing their ability to infect host cells. This antibody is widely used in Life Sciences research to study the mechanisms of enterovirus infection and develop potential antiviral therapies. Additionally, Enterovirus antibody can be used in diagnostic assays to detect the presence of enteroviruses in patient samples. Its high specificity and sensitivity make it a valuable tool for detecting and studying these viral infections.

MDR1 antibody is a chemokine that belongs to the group of polyclonal antibodies. It targets the MDR1 protein, also known as P-glycoprotein, which plays a crucial role in multidrug resistance in cancer cells. The MDR1 antibody can be used for various applications, including telomerase detection, microsphere-based immunoassays, and helicobacter pylori diagnosis. It can also be used to detect autoantibodies and colloidal gold-labeled antibodies. Additionally, the MDR1 antibody has been shown to have anti-connexin agent activity and can inhibit annexin binding. It can be used as a substrate for siRNA delivery or as a monoclonal antibody for macrophage inflammatory response studies. The MDR1 antibody is an essential tool for researchers studying phosphorylcholine antigens and their interactions with immune cells.

Kallikrein antibody is a powerful tool used in life sciences research. It targets kallikrein, an enzyme involved in various physiological processes such as blood pressure regulation, inflammation, and tissue remodeling. This antibody can inhibit the activity of kallikrein by binding to its active site, thus preventing its interaction with substrates.

Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.

CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen

GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen

Rabbit polyclonal Casein kinase 2 antibody (HRP)

The TBLR1 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody specifically targets caspase-9, an enzyme involved in programmed cell death.

The Cytoglobin antibody is a polyclonal antibody that has been developed to target the Cytoglobin protein. This protein is involved in various biological processes, including cell growth and differentiation. The antibody can be used in research studies to investigate the role of Cytoglobin in different cellular pathways.

Affinity purified Rabbit polyclonal GNAT2 antibody

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Rabbit polyclonal Zap 70 antibody

The ALK antibody is a highly effective multidrug that is commonly used in immunoassays. This monoclonal antibody specifically targets the epidermal growth factor and histidine receptors, making it a versatile tool for various applications. The ALK antibody has been extensively studied and has shown excellent results in chemokine and cytotoxic assays, as well as in the detection of growth factors. It can be used in conjunction with other Polyclonal Antibodies to enhance its efficacy. The ALK antibody is activated upon binding to its target, allowing for accurate and reliable results. It is also compatible with ophthalmic formulations and can be used in colloidal or phosphatase-based assays. With its high specificity and sensitivity, the ALK antibody is an essential tool for researchers and clinicians alike.

Rabbit polyclonal FOXD4L1 antibody

Affinity purified Rabbit polyclonal RASSF2 antibody

Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.

The IGFBP1 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes insulin-like growth factor binding protein 1 (IGFBP1). IGFBP1 is a key regulator of neurotrophic factors, such as TGF-β1, and plays a crucial role in various biological processes. By blocking the activity of IGFBP1, this antibody can modulate important cellular functions including natriuretic signaling, collagen synthesis, chemokine production, protein kinase activation, and nuclear events. Whether you are conducting research or developing therapeutics, the IGFBP1 antibody is an invaluable asset that can help unravel the complex mechanisms underlying various diseases and pave the way for novel treatments.

ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

CD86 antibody (Spectral Red) was raised in rat using murine CD86 as the immunoge.

IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV

Rabbit polyclonal ZNF133 antibody

The CMTM6 antibody is a hormone peptide that binds to specific proteins in the body. It is a powerful tool for researchers and healthcare professionals working in the field of hormone regulation. This antibody has been extensively studied and proven to be effective in various applications.

The COX2 antibody is a powerful tool used in immunoassay tests to detect the presence of cyclooxygenase-2 (COX-2) protein. This polyclonal antibody is produced by hybridoma cells and has high specificity for COX-2. It has been extensively tested and validated for use in various applications, including western blotting, immunohistochemistry, and flow cytometry.

Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The RAD51A antibody is a highly specialized polyclonal antibody that is commonly used in life sciences research. It is also available as a monoclonal antibody for more specific applications. This antibody plays a crucial role in DNA repair and recombination processes by binding to the RAD51 protein, which is involved in homologous recombination. The RAD51A antibody can be used in various techniques, such as immunofluorescence, immunohistochemistry, and western blotting, to study the expression and localization of RAD51A in different cell types and tissues. It is often conjugated with colloidal gold or fluorescent dyes like fluorescein isothiocyanate (FITC) for easy detection. The RAD51A antibody has high affinity and specificity for its target antigen, allowing for accurate quantitation and neutralizing activity against the RAD51 protein. Researchers rely on this antibody to gain insights into DNA repair mechanisms, cancer biology, and other areas of scientific interest.

The TAF1 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes the endonuclease activity of TAF1, an enzyme involved in various cellular processes such as carbonic and glutamate metabolism, growth factor signaling, and histidine biosynthesis. This monoclonal antibody has been extensively tested and proven to effectively inhibit TAF1's hyaluronidase activity, which is crucial for tissue remodeling and cell migration. Additionally, it has been shown to reduce microvessel density in tumor models, making it a potential therapeutic option for angiogenesis-related disorders. With its high specificity and affinity, the TAF1 antibody is an invaluable asset for researchers in need of reliable tools to study TAF1 function and its implications in various biological processes.

Affinity purified Rabbit polyclonal NGF beta antibody

PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM

Affinity purified Rabbit polyclonal PPP1R15B antibody

The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.

Rabbit polyclonal Mammaglobin B antibody

The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.