Anticorps primaires

COL4A3 antibody is a high-quality antibody used in Life Sciences research. It is specifically designed to target and bind to the COL4A3 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its specificity and sensitivity.

Rabbit polyclonal CSFR antibody (Tyr561)

ARID2 antibody was raised in mouse using recombinant Human At Rich Interactive Domain 2 (Arid, Rfx-Like) (Arid2)

Rabbit polyclonal CADM4 antibody

KRT8 antibody was raised in Rabbit using Human KRT8 as the immunogen

Transferrin antibody was raised in rabbit using human transferrin as the immunogen.

The AK3 antibody is a nuclear monoclonal antibody that targets growth factors in various biological processes. It has been shown to have a high affinity for echinococcus and sulphates. This antibody specifically binds to actin, a protein involved in cellular structure and movement. Additionally, it has been found to interact with tyrosine kinase-like receptors, which play a role in cell signaling pathways. The AK3 antibody is also effective in detecting steroid hormones and collagen, making it a valuable tool for research in the life sciences field. With its unique properties and buffered formulation, this antibody offers reliable and accurate results for your experiments and assays.

Rabbit monoclonal VEGF antibody (biotin)

Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.

TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA

FTCD antibody is a highly specialized monoclonal antibody that targets the lipoprotein lipase (LPL) enzyme. LPL plays a crucial role in lipid metabolism and is involved in the breakdown of triglycerides into fatty acids for energy utilization. The FTCD antibody specifically binds to LPL, inhibiting its activity and preventing the hydrolysis of triglycerides.

WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Affinity purified Rabbit polyclonal SH3BP1 antibody

CD24 antibody (PE) was raised in rat using murine heat stable antigen as the immunogen.

CD5 antibody (PE) was raised in rat using CD5/Lyt-1 as the immunogen.

Affinity purified Rabbit polyclonal Lefty A antibody

The BMP10 antibody is a highly specialized monoclonal antibody that targets mesothelin, a protein expressed in various cancers such as pancreatic, ovarian, and lung cancer. This antibody has been shown to inhibit the growth of amyloid plaques associated with Alzheimer's disease and reduce the expression of osteopontin, a protein involved in tumor progression. The BMP10 antibody can be used in various life science research applications, including immunohistochemistry, western blotting, and flow cytometry. It has also been shown to modulate the activity of β-catenin and oncostatin M signaling pathways. With its high specificity and affinity for mesothelin, this antibody is a valuable tool for studying cancer biology and developing targeted therapies.

The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.

FITC antibody (HRP) was raised in goat using fluorescein conjugated to goat IgG as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Rabbit polyclonal CYB5 antibody (biotin)

KCNK5 antibody was raised in Rabbit using Human KCNK5 as the immunogen

The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.

The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.

Rabbit polyclonal TRIP13 antibody

Rabbit polyclonal RDH13 antibody

Affinity purified Rabbit polyclonal PDE4B antibody

TNIP1 antibody was raised in rabbit using the N terminal of TNIP1 as the immunogen

Affinity purified Rabbit polyclonal NR0B2 antibody

The BTK antibody is a powerful tool in the field of Life Sciences. It targets the Bruton's tyrosine kinase (BTK), which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the effects of BTK inhibition on cell signaling pathways and protein kinase activity.

Anti-Feline Leukemia Virus antibody

DOK4 antibody was raised in rabbit using the C terminal of DOK4 as the immunogen

FAM117B antibody was raised in Rabbit using Human FAM117B as the immunogen

The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.

Affinity purified Rabbit polyclonal HRH3 antibody

The RPS3 antibody is a monoclonal antibody that specifically targets the tyrosine kinase receptor. It has been shown to have cytotoxic effects when used in combination with doxorubicin, a commonly used chemotherapy drug. The RPS3 antibody works by binding to the receptor and activating downstream signaling pathways that lead to cell death. Additionally, this antibody has been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. Furthermore, the RPS3 antibody has been shown to neutralize extracellular histones, which are released during cell death and can cause tissue damage. This highly specific and potent antibody is an essential tool for researchers in the life sciences field studying growth factors and tyrosine kinase receptors. Whether you're conducting experiments or developing new therapeutics, the RPS3 antibody is a valuable asset for your research endeavors.

Rabbit polyclonal WRKY63.1 antibody

CREB5 antibody was raised in Rabbit using Human CREB5 as the immunogen

Rabbit polyclonal TERF1 antibody

EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Rabbit polyclonal HTR4 antibody

The PDIA4 antibody is a powerful tool in the field of Life Sciences. It is designed to target and detect PDIA4, a protein that plays a crucial role in various cellular processes. PDIA4 is involved in oxidative damage repair, actin dynamics, autoantibody production, and the regulation of growth factors such as erythropoietin and epidermal growth factor.

CD44 antibody (Spectral Red) was raised in rat using murine CD44 as the immunogen.