Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Degré de pureté :Min. 95%CD24 antibody (Azide Free)
CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.
ICAM1 antibody
ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.
Degré de pureté :Min. 95%BRAF antibody
The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.
REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
HSL antibody
The HSL antibody is a monoclonal antibody that specifically targets and inhibits the activity of phosphatase enzymes. This antibody is widely used in Life Sciences research to study the role of phosphatases in various cellular processes. It has been shown to effectively block the activity of phosphatases involved in signal transduction pathways, such as those activated by growth factors and cytokines like TNF-α and chemokines.
Keratin K18 antibody
Keratin K18 antibody was raised in mouse using human keratin K18 from HeLa cytoskeletal preparation as the immunogen.JAK1 antibody
The JAK1 antibody is a highly effective chemokine inhibitor that has cytotoxic properties. It works by binding to the glucagon acid complex, preventing the activation of receptors and inhibiting cell signaling. This monoclonal antibody is specifically designed to target JAK1, a key protein involved in immune response and inflammation. By blocking the receptor binding, it prevents the release of pro-inflammatory cytokines and reduces inflammation in various tissues. The JAK1 antibody is widely used in life sciences research and has shown promising results in treating autoimmune diseases and certain types of cancer. Its high specificity and affinity make it an excellent tool for studying protein-protein interactions and developing targeted therapies.
Ubiquitin antibody
The Ubiquitin antibody is a highly specific monoclonal antibody that targets the ubiquitin molecule. It is widely used in life sciences research for various applications, including immunoassays and the detection of target molecules. This antibody has been shown to have a high affinity for ubiquitin and can effectively detect its presence in samples.ApoA-IV antibody
ApoA-IV antibody was raised in Mouse using a purified recombinant fragment of APOA4(aa21-396) expressed in E. coli as the immunogen.PNPase antibody
The PNPase antibody is a valuable tool in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-synuclein protein. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
UBE2J2 antibody
UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
Cytokeratin 19 antibody
The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.
DDX3Y antibody
The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.
ARHGAP25 antibody
ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
WNT10B antibody
WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.
ND2 antibody
The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.
NUFIP1 antibody
The NUFIP1 antibody is a powerful medicament that acts as an interferon and carboxyl esterase inhibitor. It has antiviral properties and is commonly used in the development of vaccines. This antibody works by inhibiting the formation of antibodies, making it an effective tool for studying immune responses. Additionally, it can be used as a fluorescence probe in various life sciences applications. With its ability to bind to specific targets, the NUFIP1 antibody is a valuable tool for researchers and scientists working in the field of medicine and immunology.
TOM20 antibody
The TOM20 antibody is a monoclonal antibody that has a wide range of applications in the field of Life Sciences. It specifically targets TOM20, a protein involved in mitochondrial import and sorting. This antibody can be used for various research purposes, including the detection and quantification of TOM20 in different biological samples.
IBA antibody
The IBA antibody is a highly effective and versatile product used in the field of Life Sciences. This colloidal, neutralizing antibody has been extensively tested and proven to be effective in various applications. It has shown excellent results in liver microsomes, where it acts as a potent inhibitor of multidrug resistance-associated protein (MRP) and chemokine receptors.
AC antibody
AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
SPO11 antibody
The SPO11 antibody is a highly specialized protein that plays a crucial role in the process of DNA recombination during meiosis. It specifically targets and binds to the SPO11 protein, which is responsible for initiating the formation of double-strand breaks in DNA. This antibody has been extensively studied in the field of life sciences and is widely used as a research tool in various applications.
West Nile virus antibody
The West Nile virus antibody is a monoclonal antibody used in Life Sciences. It binds to specific proteins and inhibits the growth factor GM-CSF, which is involved in the production of white blood cells. This antibody can be used as a research tool for studying the effects of GM-CSF inhibitors on cell growth and differentiation. Additionally, it has been shown to interact with other antibodies, such as transferrin and actin filaments, further expanding its potential applications in various experimental settings. With its ability to modulate colony-stimulating factors and impact cell function, this antibody offers promising opportunities for scientific advancements in the field of immunology and beyond.
CD56 antibody
CD56 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CD56 antigen, which is expressed on various cell types, including natural killer cells and neural tissues. This antibody is commonly used in studies involving growth factors such as GM-CSF and TGF-β1, as well as colony-stimulating factors. CD56 antibody has been shown to have high affinity and specificity for its target antigen, making it a valuable tool for detecting and analyzing CD56-expressing cells in samples such as human serum or tissue sections. Its binding mechanism involves disulfide bonds, ensuring stable and reliable results. Additionally, this antibody can be utilized in techniques such as immunohistochemistry or flow cytometry to investigate the role of CD56 in various biological processes.DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
