Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
CD8a antibody (biotin)
CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Degré de pureté :Min. 95%PKC delta antibody
The PKC delta antibody is a powerful tool used in life sciences research. It specifically targets and detects the protein kinase C delta (PKC δ), which plays a crucial role in cell signaling pathways. This polyclonal antibody can be used to study various biological processes, including androgen and epidermal growth factor signaling, histidine phosphorylation, and cholinergic neurotransmission.
Degré de pureté :Min. 95%IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. IL-6 acts as both a pro-inflammatory and anti-inflammatory mediator, playing a crucial role in immune response regulation. The IL6 antibody binds to IL-6 and neutralizes its activity, preventing it from binding to its receptors and initiating downstream signaling pathways.
ACTR1A antibody
ACTR1A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP
Rbm3 antibody
Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen
Degré de pureté :Min. 95%SFRP2 antibody
SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
SLC18A2 antibody
The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.STUB1 antibody
STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
ZNF12 antibody
ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen
Degré de pureté :Min. 95%PPP1R9B antibody
The PPP1R9B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein PPP1R9B, also known as neurabin-2 or spinophilin. This antibody is commonly used in various applications, including immunohistochemistry, western blotting, and ELISA assays.
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
HIF3A antibody
HIF3A antibody was raised in rabbit using the C terminal of HIF3A as the immunogen
Degré de pureté :Min. 95%MDMA antibody
The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.
Degré de pureté :Min. 95%GFAP antibody
The GFAP antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in various life sciences applications, including immunoassays and protein detection. This antibody can be used to detect and quantify GFAP levels in various samples, such as human serum or tissue lysates. The GFAP antibody has been shown to inhibit the activity of phosphatase enzymes that are involved in signal transduction pathways. It is also conjugated to magnetic particles, allowing for easy purification and separation of the target molecule. Additionally, this antibody has been found to react with actin filaments, providing valuable insights into cellular structure and function. With its high specificity and sensitivity, the GFAP antibody is an essential tool for researchers studying glial cells and their role in various physiological processes.
Aromatase antibody
The Aromatase antibody is a protein that belongs to the group of Polyclonal Antibodies. It plays a crucial role in the process of glycosylation, which is important for the proper functioning of various biological processes. This antibody can bind to specific targets and help in the detection and analysis of glycoproteins. Additionally, it has been shown to have cholinergic and acetyltransferase activities, making it valuable in research related to neurotransmission and signal transduction. The Aromatase antibody can also be used to detect autoantibodies and phosphatases in biological samples. Furthermore, studies have indicated its involvement in regulating interleukin-6 levels, suggesting its potential role in modulating immune responses. Overall, this monoclonal antibody is an essential tool for researchers in Life Sciences and offers insights into various cellular processes, including genotoxicity and interferon signaling pathways.
KCNAB2 antibody
KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL
C14ORF21 antibody
C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
RIPK4 antibody
RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
ApoD antibody
The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.
Endomucin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
HIV1 p24 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.
